DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and GR

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_191026.1 Gene:GR AraportID:AT3G54660 Length:565 Species:Arabidopsis thaliana

Alignment Length:508 Identity:169/509 (33%)
Similarity:249/509 (49%) Gaps:43/509 (8%)


  Fly     9 SSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARV----LCFDYVKPTPV 69
            :||.|.          |.|...||:||..:|.||.|:..::.|...||..    |.|..:.....
plant    74 ASTDNG----------AESDRHYDFDLFTIGAGSGGVRASRFATSFGASAAVCELPFSTISSDTA 128

  Fly    70 GTKWGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVN 134
            |   |:|||||..||:||||:..||.......::..:||.. :|....||..|:.:....::.:.
plant   129 G---GVGGTCVLRGCVPKKLLVYASKYSHEFEDSHGFGWKY-ETEPSHDWTTLIANKNAELQRLT 189

  Fly   135 WVTRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELG 199
            .:.:..|....|:.:.......|.||::      .:.:..|:..:::||||||..|||||. |..
plant   190 GIYKNILSKANVKLIEGRGKVIDPHTVD------VDGKIYTTRNILIAVGGRPFIPDIPGK-EFA 247

  Fly   200 ITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVR-SIVLRGFDRQMSELLAAMMT 263
            |.||.......:|.:..:||.||:.||.|....||..|..|.:| ..||||||..:.:.:...|:
plant   248 IDSDAALDLPSKPKKIAIVGGGYIALEFAGIFNGLNCEVHVFIRQKKVLRGFDEDVRDFVGEQMS 312

  Fly   264 ERGIPFLGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVK- 327
            .|||.|.....|:|:.:..||...::....|  ::|   |..|::|.|||...::|.|:..||| 
plant   313 LRGIEFHTEESPEAIIKAGDGSFSLKTSKGT--VEG---FSHVMFATGRKPNTKNLGLENVGVKM 372

  Fly   328 THDDKIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVF 392
            ..:..|.||....||||.|:||||:. .|..|||||::.|..||:.||.......||..|...||
plant   373 AKNGAIEVDEYSQTSVPSIWAVGDVT-DRINLTPVALMEGGALAKTLFQNEPTKPDYRAVPCAVF 436

  Fly   393 TPLEYSCVGMSEETAIELRGADNIEVFHGYYKP---TEFFIPQKSVRHCYLKAVAEVSGDQKILG 454
            :......||::||.|||..|  :::|:...::|   |...:|.:    .::|.:. .:...|:||
plant   437 SQPPIGTVGLTEEQAIEQYG--DVDVYTSNFRPLKATLSGLPDR----VFMKLIV-CANTNKVLG 494

  Fly   455 LHYIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGR 507
            :|..|..:.|:||||..|:|.|||......|||:|||.||||..:....|..|
plant   495 VHMCGEDSPEIIQGFGVAVKAGLTKADFDATVGVHPTAAEEFVTMRAPTRKFR 547

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 13/43 (30%)
TGR 31..515 CDD:273624 164/487 (34%)
NADB_Rossmann <144..239 CDD:304358 31/95 (33%)
Pyr_redox 214..288 CDD:278498 27/75 (36%)
Pyr_redox_dim 388..497 CDD:280934 40/112 (36%)
GRNP_191026.1 PLN02546 1..565 CDD:215301 169/509 (33%)
NADB_Rossmann <219..>285 CDD:304358 26/67 (39%)
Pyr_redox 262..334 CDD:278498 27/72 (38%)
Pyr_redox_dim 432..538 CDD:280934 40/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 264 1.000 Inparanoid score I926
OMA 1 1.010
OrthoDB 1 1.010 D581771at2759
OrthoInspector 1 1.000 T32365
orthoMCL 1 0.900 OOG5_126785
Panther 1 1.100 O PTHR43256
Phylome 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.