DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and GR1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001030756.2 Gene:GR1 AraportID:AT3G24170 Length:499 Species:Arabidopsis thaliana

Alignment Length:506 Identity:163/507 (32%)
Similarity:257/507 (51%) Gaps:49/507 (10%)


  Fly    26 ASRPRYDYDLVVLGGGSAGLACAKEAAGCGARV-LC---FDYVKPTPVGTKWGIGGTCVNVGCIP 86
            |:...||:||.|:|.||.|:..|:.:|..||:| :|   |..:....:|   |:|||||..||:|
plant    19 ANATHYDFDLFVIGAGSGGVRAARFSANHGAKVGICELPFHPISSEEIG---GVGGTCVIRGCVP 80

  Fly    87 KKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNS 151
            ||::...:..|..:.:|..|||.::: .:...|:||::...:.|..:|.:.:..|.:..|:....
plant    81 KKILVYGATYGGELEDAKNYGWEINE-KVDFTWKKLLQKKTDEILRLNNIYKRLLANAAVKLYEG 144

  Fly   152 MATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTL 216
            .......:.:|...:.|.: ...|::::::|.|.|.:.|:|||. ||.||||:..|.|..|.|.:
plant   145 EGRVVGPNEVEVRQIDGTK-ISYTAKHILIATGSRAQKPNIPGH-ELAITSDEALSLEEFPKRAI 207

  Fly   217 VVGAGYVGLECACFLKGLGYEPTVMVR-SIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVER 280
            |:|.||:.:|.|...:|:|....:..| .:.|||||.:|..|:|..:..||:.            
plant   208 VLGGGYIAVEFASIWRGMGATVDLFFRKELPLRGFDDEMRALVARNLEGRGVN------------ 260

  Fly   281 QADGRLLVRYRNTTTQMDGSD-------------VFDTVLWAIGRKGLIEDLNLDAAGVKTHD-D 331
                   :..:.:.||:..:|             |.|.||:|.||....:.|||:|.||:... .
plant   261 -------LHPQTSLTQLTKTDQGIKVISSHGEEFVADVVLFATGRSPNTKRLNLEAVGVELDQAG 318

  Fly   332 KIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLE 396
            .:.||....|::|.|:||||.. .|..|||||::.....|...|.|.....:|::||..||....
plant   319 AVKVDEYSRTNIPSIWAVGDAT-NRINLTPVALMEATCFANTAFGGKPTKAEYSNVACAVFCIPP 382

  Fly   397 YSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPV 461
            .:.||:|||.|:| :...:|.||...:.|.:..|..:..: ..:|.:.:...| |::|....||.
plant   383 LAVVGLSEEEAVE-QATGDILVFTSGFNPMKNTISGRQEK-TLMKLIVDEKSD-KVIGASMCGPD 444

  Fly   462 AGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEF-TRLSITKRSGRDPTP 511
            |.|::||.|.|||.|.|.....:||||||::|||| |..|:|:|....|.|
plant   445 AAEIMQGIAIALKCGATKAQFDSTVGIHPSSAEEFVTMRSVTRRIAHKPKP 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 16/43 (37%)
TGR 31..515 CDD:273624 162/502 (32%)
NADB_Rossmann <144..239 CDD:304358 29/95 (31%)
Pyr_redox 214..288 CDD:278498 20/75 (27%)
Pyr_redox_dim 388..497 CDD:280934 41/110 (37%)
GR1NP_001030756.2 PLN02507 1..499 CDD:215281 163/507 (32%)
Pyr_redox 205..280 CDD:278498 23/94 (24%)
Pyr_redox_dim 374..481 CDD:280934 41/110 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 264 1.000 Inparanoid score I926
OMA 1 1.010
OrthoDB 1 1.010 D581771at2759
OrthoInspector 1 1.000 T32365
orthoMCL 1 0.900 OOG5_126785
Panther 1 1.100 O PTHR43256
Phylome 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.