DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and LPD1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001078165.1 Gene:LPD1 AraportID:AT3G16950 Length:623 Species:Arabidopsis thaliana

Alignment Length:559 Identity:139/560 (25%)
Similarity:226/560 (40%) Gaps:109/560 (19%)


  Fly     4 IKFL--RSSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKP 66
            |:||  :|...:|..||.|   ..|....:||||:::|.|..|...|..|...|.:....:    
plant    59 IQFLSRKSFQVSASASSNG---NGAPPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIE---- 116

  Fly    67 TPVGTKWG--IGGTCVNVGCIPKKLMHQAS-----LLGEAVHEAVAYGWNV-----DDTNIRPDW 119
                   |  :||||||.||:|.|.:...|     |..|  |...::|..|     |...:....
plant   117 -------GDVVGGTCVNRGCVPSKALLAVSGRMRELQNE--HHMKSFGLQVSAAGYDRQGVADHA 172

  Fly   120 RKLVRSVQNHIKSVNWVTRVD--------LRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTS 176
            ..|...::|::.:......||        |..:||:|                    .:...:|:
plant   173 NNLATKIRNNLTNSMKAIGVDILTGFGSVLGPQKVKY--------------------GKDNIITA 217

  Fly   177 EYVVVAVGGRPRYPDIPGAVELG----ITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYE 237
            :.:::|.|.   .|.:|..:|:.    ||||.....|..|....:||:||:|||.:.....||.|
plant   218 KDIIIATGS---VPFVPKGIEVDGKTVITSDHALKLESVPEWIAIVGSGYIGLEFSDVYTALGSE 279

  Fly   238 PT-VMVRSIVLRGFDRQMSELL-AAMMTERGIPFLGTTIPKAVERQADGR-LLVRYRNTTTQ--M 297
            .| :.....::.|||.::|:|. ..::..|.|.:........:....||: :|:...:..|:  .
plant   280 VTFIEALDQLMPGFDPEISKLAQRVLINPRKIDYHTGVFASKITPARDGKPVLIELIDAKTKEPK 344

  Fly   298 DGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTH------DDKIVVDAAEATSVPHIFAVGDIIYGR 356
            |..:| |..|.|.||......|.|:...|.|.      |:::.|...:.|.||:::.:|| ..|:
plant   345 DTLEV-DAALIATGRAPFTNGLGLENVNVVTQRGFIPVDERMRVIDGKGTLVPNLYCIGD-ANGK 407

  Fly   357 PELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADNIEVFHG 421
            ..|...|...|..:..:: :|...::::..:....||..|.|.||::|..|.| :|..  |.|..
plant   408 LMLAHAASAQGISVVEQV-SGRDHVLNHLSIPAACFTHPEISMVGLTEPQAKE-KGEK--EGFKV 468

  Fly   422 YYKPTEFFIPQKSVRHCYLKAVAEVSGD-----------QKILGLHYIGPVAGEVIQGFAAALKT 475
            ....|.|        ....||:||..|:           .:|||:|..|..|.::|...:.|:..
plant   469 SVVKTSF--------KANTKALAENEGEGIAKMIYRPDNGEILGVHIFGLHAADLIHEASNAIAL 525

  Fly   476 GLTVKTLLNTVGIHPTTAEEFTRL--------SITKRSG 506
            |..::.:...|..|||.:|....|        ..|.|:|
plant   526 GTRIQDIKLAVHAHPTLSEVLDELFKAAKVESHATTRTG 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 10/39 (26%)
TGR 31..515 CDD:273624 130/531 (24%)
NADB_Rossmann <144..239 CDD:304358 25/99 (25%)
Pyr_redox 214..288 CDD:278498 21/77 (27%)
Pyr_redox_dim 388..497 CDD:280934 33/120 (28%)
LPD1NP_001078165.1 PRK06416 103..553 CDD:235798 119/500 (24%)
Pyr_redox 257..334 CDD:278498 21/77 (27%)
Pyr_redox_dim 438..548 CDD:280934 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D581771at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.