DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and txnrd2.2

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001340325.1 Gene:txnrd2.2 ZFINID:ZDB-GENE-040914-66 Length:517 Species:Danio rerio

Alignment Length:488 Identity:270/489 (55%)
Similarity:343/489 (70%) Gaps:5/489 (1%)


  Fly    30 RYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQAS 94
            ::||||||:||||.||||:||||..|.:|...|||:|:..|||||:||||||||||||||||||:
Zfish    30 KFDYDLVVIGGGSGGLACSKEAAQLGQKVAVLDYVEPSLKGTKWGLGGTCVNVGCIPKKLMHQAA 94

  Fly    95 LLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSH 159
            |||.||.:|..|||.:.:| :..||..:..:||||::|:||..||.|:||||:|:|...|..|.|
Zfish    95 LLGTAVKDARKYGWQIPET-LSHDWPTMAEAVQNHVRSLNWGHRVQLQDKKVKYLNMKGTLLDKH 158

  Fly   160 TIEYVAMPGAEHRQVTSEYVVVAVGGRPRYP-DIPGAVELGITSDDIFSYEREPGRTLVVGAGYV 223
            |:..|...|.| ..||:..:::|.||||:|| .:|||:|.||||||||..:..|.:||::||.||
Zfish   159 TVRAVNAQGKE-MTVTARNILLATGGRPKYPTHVPGAMEFGITSDDIFWLKESPKKTLIIGASYV 222

  Fly   224 GLECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADGRLLV 288
            .||||.||.|:|.:.:||||||.|||||:|||.|:...|...|..|.....||:||:...|.|.|
Zfish   223 SLECAGFLTGIGLDTSVMVRSIALRGFDQQMSGLVTDYMETYGTKFHWKCTPKSVEKLPSGHLQV 287

  Fly   289 RYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDD--KIVVDAAEATSVPHIFAVGD 351
            .:.:..|:.:..|.|::||||:||....:.|||:..|||.:.:  ||:|.|.||||||:|||:||
Zfish   288 TWMDLNTKEEHQDTFNSVLWAVGRAPETKTLNLEKVGVKINKETGKIIVAADEATSVPNIFAIGD 352

  Fly   352 IIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADNI 416
            |..|||||||.||.:|:|||.||...||:||:|.:|||||||||||.|||:|||.|....|.|.|
Zfish   353 IGEGRPELTPTAIKAGKLLAHRLAGRSTELMNYENVATTVFTPLEYGCVGLSEEEAERRHGKDQI 417

  Fly   417 EVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVKT 481
            ||:|.:|||.||.:.::....||:|.|....|||::||||:.||.||||.||||...:.|||.:.
Zfish   418 EVYHAFYKPLEFTVAERDATQCYIKVVCLREGDQRVLGLHFTGPNAGEVTQGFALGFQCGLTYEH 482

  Fly   482 LLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            |.||||||||.|||.|:|:||||||.|.|...|
Zfish   483 LRNTVGIHPTCAEELTKLNITKRSGLDATVTGC 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 24/38 (63%)
TGR 31..515 CDD:273624 270/488 (55%)
NADB_Rossmann <144..239 CDD:304358 48/96 (50%)
Pyr_redox 214..288 CDD:278498 38/74 (51%)
Pyr_redox_dim 388..497 CDD:280934 64/109 (59%)
txnrd2.2NP_001340325.1 Pyr_redox_dim 31..517 CDD:332164 270/488 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 554 1.000 Inparanoid score I1067
OMA 1 1.010
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 1 1.000 T596549
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43256
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R529
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1010.060

Return to query results.
Submit another query.