DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and aifm4

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_005157647.1 Gene:aifm4 ZFINID:ZDB-GENE-070112-2282 Length:530 Species:Danio rerio

Alignment Length:468 Identity:101/469 (22%)
Similarity:181/469 (39%) Gaps:124/469 (26%)


  Fly    23 RLAASRPRYDYDLVVLGGGSAGLACAK--EAAGCGARVLCFDYVKPTPVG-TKWGIGGTCVNVGC 84
            ::::..|..::.:|::|||.|.|.||:  .....|.|::.....:..|:. ||.   ...:|:. 
Zfish   119 KMSSRVPGVNHTVVLIGGGPASLQCAETLRQNDYGGRIVMVTKDEQLPLDKTKL---SKAMNIE- 179

  Fly    85 IPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDW-RKLVRSVQNHIKSVNWVTRVDLRDKKVEY 148
            |.|.|:.|:..|.:       ||..|        | :|.|:||....|:|               
Zfish   180 IEKVLLRQSDFLQQ-------YGIEV--------WTKKEVKSVDTDAKTV--------------- 214

  Fly   149 VNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGA----VELGITSDDIFSYE 209
                 ||:|.....|             :.::::.|||.|..:.|||    |:|..|.:|.....
Zfish   215 -----TFQDGTLQNY-------------DQLLISTGGRARPLECPGAELENVKLLQTYEDASEIH 261

  Fly   210 REPG--RTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMS------ELLAAMMTERG 266
            |...  :.::||..::|:|.|.:|.......||:..|    .|..|.|      ::...|:.|:.
Zfish   262 RISAGKKAVIVGTSFIGMEVAAYLSDKAASVTVIGTS----KFPFQASLGSDIGKMTMQMLEEKN 322

  Fly   267 IPFLGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVF--DTVLWAIG--------RKGLIEDLNL 321
            :.|. |:...|..|..:|::      ....:...:|.  |.::..||        ::.|:|    
Zfish   323 VKFY-TSNGVAEIRGENGKV------KEVVLKNGEVLPADIIIAGIGVIPNSDFLKETLVE---- 376

  Fly   322 DAAGVKTHDDKIVVDAAEATSVPHIFAVGDII------YGRPELT----PVAILSGRLLARRLFA 376
                :.:| ..:|||....|::|.:||.||::      .|...:.    .:|...||:      |
Zfish   377 ----IDSH-KAVVVDKFMKTNIPDVFAAGDVVSFPLTLVGHKRVNIGHWQLAQAHGRI------A 430

  Fly   377 GSTQLMDYADVATTVF-------TPLEYSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKS 434
            |.:.|....::.|..:       ..:.|:..| ...|.|..:|:.....|..:|...|..:...|
Zfish   431 GLSMLNRQVEINTVPYFWTMLLGKSIRYTGYG-EGYTEIVFKGSTEERKFLAFYIKDEEVVAAAS 494

  Fly   435 VRHCYLKAVAEVS 447
            :.  :..|||.::
Zfish   495 LN--FDPAVARLA 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 11/41 (27%)
TGR 31..515 CDD:273624 100/461 (22%)
NADB_Rossmann <144..239 CDD:304358 22/101 (22%)
Pyr_redox 214..288 CDD:278498 19/80 (24%)
Pyr_redox_dim 388..497 CDD:280934 13/68 (19%)
aifm4XP_005157647.1 Rieske_AIFL_N 13..105 CDD:239560
Pyr_redox_2 129..427 CDD:285266 82/370 (22%)
TIM_phosphate_binding <132..277 CDD:304361 47/197 (24%)
Pyr_redox 268..349 CDD:278498 19/92 (21%)
Reductase_C 446..519 CDD:291425 12/64 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79924410
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.