DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and TXNRD1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001087240.1 Gene:TXNRD1 HGNCID:12437 Length:649 Species:Homo sapiens

Alignment Length:489 Identity:250/490 (51%)
Similarity:332/490 (68%) Gaps:7/490 (1%)


  Fly    31 YDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASL 95
            |||||:::||||.|||.|||||..|.:|:..|:|.|||:||:||:||||||||||||||||||:|
Human   161 YDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAAL 225

  Fly    96 LGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHT 160
            ||:|:.::..|||.|::| ::.||.:::.:|||||.|:||..||.||:|||.|.|:...|...|.
Human   226 LGQALQDSRNYGWKVEET-VKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHR 289

  Fly   161 IEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGL 225
            |:.....|.| :..::|..::|.|.||||..|||..|..|:|||:||....||:||||||.||.|
Human   290 IKATNNKGKE-KIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVAL 353

  Fly   226 ECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIP---KAVERQADGRLL 287
            |||.||.|:|.:.|||||||:|||||:.|:..:...|.|.||.|:...:|   :.:|....|||.
Human   354 ECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLR 418

  Fly   288 VRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD--DKIVVDAAEATSVPHIFAVG 350
            |..::|.::......::||:.||||......:.|:..|||.::  .||.|...|.|:||:|:|:|
Human   419 VVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIG 483

  Fly   351 DIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADN 415
            ||:..:.|||||||.:|||||:||:||||...||.:|.|||||||||...|:|||.|:|..|.:|
Human   484 DILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEEN 548

  Fly   416 IEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVK 480
            |||:|.|:.|.|:.||.:....||.|.:.....:::::|.|.:||.||||.||||||||.|||.|
Human   549 IEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 613

  Fly   481 TLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            .|.:|:||||..||.||.||:|||||.....|.|
Human   614 QLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 23/37 (62%)
TGR 31..515 CDD:273624 250/490 (51%)
NADB_Rossmann <144..239 CDD:304358 45/95 (47%)
Pyr_redox 214..288 CDD:278498 39/77 (51%)
Pyr_redox_dim 388..497 CDD:280934 58/109 (53%)
TXNRD1NP_001087240.1 GRX_GRXh_1_2_like 68..148 CDD:239511
TGR 161..649 CDD:273624 250/490 (51%)
Pyr_redox 342..418 CDD:278498 39/76 (51%)
Pyr_redox_dim 521..631 CDD:280934 59/110 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.879 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.