DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Eid3

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_079775.2 Gene:Eid3 MGIID:1913591 Length:375 Species:Mus musculus

Alignment Length:234 Identity:46/235 (20%)
Similarity:86/235 (37%) Gaps:53/235 (23%)


  Fly   278 VERQADGRLLVRYRNT--TTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGV-KTHDDKIVVDAAE 339
            |:|:...::..:||..  |.|.:..|:.:|....:..  .:|:.|:...|| :|.:        .
Mouse    75 VDREKCRKIRRQYRQLIYTVQQNREDIVNTASDTLSE--ALEEANVLFDGVSRTRE--------A 129

  Fly   340 ATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMS- 403
            |.....:....|:              |:..|::|   :|.:..:..:|   |..|....||.: 
Mouse   130 ALDAQFLVLASDL--------------GKEKAKQL---NTDMNFFNPIA---FCDLLLLFVGFNW 174

  Fly   404 -EETAIELRGADNIEV--FHG--YYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAG 463
             ||...|....|:..|  |.|  :.:.|.:.:..::....:....||.|..:..||.|       
Mouse   175 VEEECKEFSDCDDSIVLSFWGMLHEEATSWMLQAETFHFIFGSFKAERSARKPRLGCH------- 232

  Fly   464 EVIQGFAAALKTGLTVKTLLNTVGIH---PTTAEEFTRL 499
                ..|..::....:.|.|..:.:|   .||.:|..|:
Mouse   233 ----KRACKMEGSGDMPTKLRRLDVHANQETTEKEVERI 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358
TGR 31..515 CDD:273624 46/235 (20%)
NADB_Rossmann <144..239 CDD:304358
Pyr_redox 214..288 CDD:278498 2/10 (20%)
Pyr_redox_dim 388..497 CDD:280934 26/118 (22%)
Eid3NP_079775.2 Nse4-Nse3_bdg 132..178 CDD:292054 12/66 (18%)
Nse4_C 283..371 CDD:285900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.