DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Txnrd1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001338913.1 Gene:Txnrd1 RGDID:61959 Length:580 Species:Rattus norvegicus

Alignment Length:489 Identity:251/490 (51%)
Similarity:333/490 (68%) Gaps:7/490 (1%)


  Fly    31 YDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASL 95
            ||:||:::||||.|||.|||||....:|:..|:|.|||:||:||:||||||||||||||||||:|
  Rat    92 YDFDLIIIGGGSGGLAAAKEAAKFDKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAAL 156

  Fly    96 LGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHT 160
            ||:|:.::..|||.::|| ::.||.|:..||||||.|:||..||.||:|||.|.|:...|...|.
  Rat   157 LGQALKDSRNYGWKLEDT-VKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHK 220

  Fly   161 IEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGL 225
            |......|.| :..::|..::|.|.||||..|||..|..|:|||:||....||:||||||.||.|
  Rat   221 IMATNNKGKE-KVYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVAL 284

  Fly   226 ECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIP---KAVERQADGRLL 287
            |||.||.|:|.:.|||||||:|||||:.|:..:...|.|.||.|:...:|   :.:|....|||.
  Rat   285 ECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLK 349

  Fly   288 VRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD--DKIVVDAAEATSVPHIFAVG 350
            |..::|.::....|.|:|||.|:||......:.|:..|||.::  .||.|...|.|:||:|:|:|
  Rat   350 VTAKSTNSEETIEDEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIG 414

  Fly   351 DIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADN 415
            ||:.|:.|||||||.:|||||:||:.|||...||.:|.|||||||||.|.|:|||.|:|..|.:|
  Rat   415 DILEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEEN 479

  Fly   416 IEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVK 480
            |||:|.::.|.|:.:|.:....||.|.|..:..:::::|.|.:||.||||.||||||||.|||.:
  Rat   480 IEVYHSFFWPLEWTVPSRDNNKCYAKVVCNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQ 544

  Fly   481 TLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            .|.:|:||||..||.||.||:|||||.|...:.|
  Rat   545 QLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGC 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 21/37 (57%)
TGR 31..515 CDD:273624 251/490 (51%)
NADB_Rossmann <144..239 CDD:304358 45/95 (47%)
Pyr_redox 214..288 CDD:278498 39/77 (51%)
Pyr_redox_dim 388..497 CDD:280934 57/109 (52%)
Txnrd1NP_001338913.1 TGR 92..580 CDD:273624 251/490 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.