DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and aifm5

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_001920911.2 Gene:aifm5 ZFINID:ZDB-GENE-091118-96 Length:543 Species:Danio rerio

Alignment Length:443 Identity:90/444 (20%)
Similarity:162/444 (36%) Gaps:131/444 (30%)


  Fly    33 YDLVVLGGGSAGLACAK--EAAGCGARVLCF--DYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQA 93
            :.:::||||:|.|.||:  .....|.|::..  |.:.|                        :..
Zfish   140 HTVMLLGGGAACLMCAETLRQENYGGRIIMVSRDDLLP------------------------YDK 180

  Fly    94 SLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSV---QNHIKSVNWVTR----VDLRDKKVEYVNS 151
            :.|.:.:        |.:..::      |:|.:   ..|...| |:.:    :|...|.|     
Zfish   181 TRLSKVM--------NAESDSL------LMRRMDFFHKHDIEV-WLKKEALSIDTNKKTV----- 225

  Fly   152 MATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGA----VELGITSDD--IFSYER 210
              ||.|.....|             :.:::|.|.|.:..|.|||    |.:..|.:|  ...|..
Zfish   226 --TFDDGLIQSY-------------DQILIATGCRAKGLDCPGANLERVLMLETPEDARCVHYAC 275

  Fly   211 EPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIV--LRGFDRQMSELLAAMMTERGIPFLGTT 273
            ...||::||..::|:|.|.:|.......||:..|.:  .:...|::.::...|:.|:|:.|.   
Zfish   276 TGCRTVIVGTSFIGMEVAAYLLDTSSSMTVIGSSELPYQKTLGREIGKVTMTMLEEKGVTFY--- 337

  Fly   274 IPKAV-ERQADGRLL--VRYRNTTTQMDGSDVFDTVLWAIGRKGLIE-DLNLDAAGVKTH----- 329
            :..|| |.|...|.:  |:.::..|                    || ||.:.|.||..:     
Zfish   338 MNDAVAEVQGKNRRVKAVKLKSGIT--------------------IEADLLIVAIGVSPNSEFLK 382

  Fly   330 ------DDK--IVVDAAEATSVPHIFAVGDIIYGRPELT----------PVAILSGRLLARRLFA 376
                  |.|  ::||....|::..::..||:.....::.          .:|...||:.|..:..
Zfish   383 GSRVRMDSKNYVIVDEYMRTNITDVYCAGDLTSFPLKMAKGQKVSLGHWQIAQAHGRIAALNMLC 447

  Fly   377 GSTQLMDYADVATTVF-TPLEYSCVGMSEETAIELRGA-DNIEVFHGYYKPTE 427
            ...:|.......|.:| ..:.|:..| ...|.:.|:|. :|::....|.|..|
Zfish   448 REVELNTVPYYWTVLFGRTIRYAGYG-EGYTEMVLKGKFENMKFLALYLKDGE 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 12/39 (31%)
TGR 31..515 CDD:273624 90/444 (20%)
NADB_Rossmann <144..239 CDD:304358 25/101 (25%)
Pyr_redox 214..288 CDD:278498 21/79 (27%)
Pyr_redox_dim 388..497 CDD:280934 11/43 (26%)
aifm5XP_001920911.2 Rieske_AIFL_N 21..114 CDD:239560
Pyr_redox_2 140..438 CDD:285266 75/380 (20%)
Pyr_redox 279..360 CDD:278498 22/84 (26%)
Reductase_C 457..535 CDD:291425 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79986034
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.