DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and gsr

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_005169649.1 Gene:gsr ZFINID:ZDB-GENE-050522-116 Length:500 Species:Danio rerio

Alignment Length:520 Identity:178/521 (34%)
Similarity:270/521 (52%) Gaps:45/521 (9%)


  Fly     1 MSTIKFLRSSTHNALRSSLGWCRL------AASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVL 59
            :|.:..||||..:..||....|:|      :.|..|:|:  :|:||||.|||.|:.||..||   
Zfish     4 LSPLARLRSSFLSLGRSLSSSCKLLGRSMASGSVSRFDF--LVVGGGSGGLAGARRAAELGA--- 63

  Fly    60 CFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVR 124
                  .|.|.....:|||||||||:|||:|...|...|.:|:...||:  :.......|:.:..
Zfish    64 ------TTAVIESHRLGGTCVNVGCVPKKVMWNTSTHAEYLHDHEDYGF--EGAKAHFSWQIIKH 120

  Fly   125 SVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRD--SHTIEYVAMPGAEHRQVTSEYVVVAVGGRP 187
            ....::..:|.:.|.:|...|:|:::..|.|.|  ..|:|      ...::.|:.:::::.||.|
Zfish   121 KRDAYVSRLNQIYRSNLEKGKIEFIHGYARFTDDPEPTVE------VNGKKYTATHILISTGGHP 179

  Fly   188 ---RYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVR-SIVLR 248
               ...|:||: .||||||..|..|..|.|:::|||||:.:|.|..|..||.:.::::| ..|||
Zfish   180 STVSEDDVPGS-SLGITSDGFFELESCPKRSVIVGAGYIAVEMAGILSTLGSKTSIIIRQGGVLR 243

  Fly   249 GFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTV------L 307
            .||..:|......:...||.....|..|:|::...|..:..........|..:.|||:      |
Zfish   244 NFDALISSNCTKELQNNGIDLRKNTQVKSVKKNGKGLSITLVTKDPDDKDSQEKFDTINDVDCLL 308

  Fly   308 WAIGRKGLIEDLNLDAAGVKTHDDK--IVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLL 370
            |||||:.....|||...|||. |::  ||||..:.||.|.::||||:. ||..||||||.:||.|
Zfish   309 WAIGREPNTAGLNLSQIGVKL-DERGHIVVDEFQNTSRPGVYAVGDVC-GRALLTPVAIAAGRKL 371

  Fly   371 ARRLFAG-STQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKS 434
            |.|||.| :...:||.::.|.||:......||::|:.|::..|.|.::|:...:.|..:.|..:.
Zfish   372 AHRLFEGKADSKVDYNNIPTVVFSHPPIGTVGLTEDEAVKTYGKDKVKVYTTSFTPMYYAITTRK 436

  Fly   435 VRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRL 499
             ..|.:|.|. ...::|::|||..|....|::||||.|:..|.|......|:.||||::||...|
Zfish   437 -SQCIMKLVC-AGENEKVVGLHMQGFGCDEMLQGFAVAVNMGATKADFDRTIAIHPTSSEELVTL 499

  Fly   500  499
            Zfish   500  499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 16/39 (41%)
TGR 31..515 CDD:273624 167/485 (34%)
NADB_Rossmann <144..239 CDD:304358 34/100 (34%)
Pyr_redox 214..288 CDD:278498 24/75 (32%)
Pyr_redox_dim 388..497 CDD:280934 35/109 (32%)
gsrXP_005169649.1 gluta_reduc_1 56..500 CDD:273614 157/467 (34%)
Pyr_redox 208..284 CDD:278498 24/76 (32%)
Pyr_redox_dim 390..498 CDD:280934 35/110 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R529
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.