DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Txnrd2

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_072106.1 Gene:Txnrd2 RGDID:61960 Length:526 Species:Rattus norvegicus

Alignment Length:520 Identity:263/521 (50%)
Similarity:353/521 (68%) Gaps:21/521 (4%)


  Fly    14 ALRSSLGWCR----------------LAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFD 62
            |||.|.|..|                .:|:..:.::||:|:||||.|||||||||..|.:|...|
  Rat     7 ALRGSSGRFRPQTRVLTRGTRGAAGAASAAGGQQNFDLLVIGGGSGGLACAKEAAQLGRKVAVAD 71

  Fly    63 YVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQ 127
            ||:|:|.|||||:||||||||||||||||||:|||..:.:|..|||.|... ::.:|:.:..:||
  Rat    72 YVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAQHYGWEVAQP-VQHNWKAMAEAVQ 135

  Fly   128 NHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYP-D 191
            ||:||:||..||.|:|:||:|.|..|:|.:.||:..|...| :..|::::::|:|.||||:|| .
  Rat   136 NHVKSLNWGHRVQLQDRKVKYFNIKASFVNEHTVHGVDKAG-KVTQLSAKHIVIATGGRPKYPTQ 199

  Fly   192 IPGAVELGITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMSE 256
            :.||:|.||||||||..:..||:||||||.||.||||.||.|:|.:.|||:||:.|||||:||:.
  Rat   200 VKGALEHGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGIGLDTTVMMRSVPLRGFDQQMAS 264

  Fly   257 LLAAMMTERGIPFLGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNL 321
            |:...|...|..||...:|..:.:....:|.|.:.:..:..:....||||||||||.....:|||
  Rat   265 LVTEHMESHGTRFLKGCVPSLIRKLPTNQLQVTWEDLASGKEDVGTFDTVLWAIGRVPETRNLNL 329

  Fly   322 DAAGVKTH--DDKIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDY 384
            :.|||.|:  :.||:|||.||||||||:|:||:..|||||||.||.:|:|||:|||..|:.||:|
  Rat   330 EKAGVNTNPKNQKIIVDAQEATSVPHIYAIGDVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMNY 394

  Fly   385 ADVATTVFTPLEYSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGD 449
            ::|.|||||||||.|||:|||.|:.|.|.::|||:|.||||.||.:..:....||:|.|......
  Rat   395 SNVPTTVFTPLEYGCVGLSEEEAVALHGQEHIEVYHAYYKPLEFTVADRDASQCYIKMVCMREPP 459

  Fly   450 QKILGLHYIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            |.:||||::||.||||.||||..::.|.:...::.|||||||.:||..:|.|:||||.|||...|
  Rat   460 QLVLGLHFLGPNAGEVTQGFALGIQCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLDPTVTGC 524

  Fly   515  514
              Rat   525  524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 22/39 (56%)
TGR 31..515 CDD:273624 256/488 (52%)
NADB_Rossmann <144..239 CDD:304358 48/96 (50%)
Pyr_redox 214..288 CDD:278498 35/74 (47%)
Pyr_redox_dim 388..497 CDD:280934 57/109 (52%)
Txnrd2NP_072106.1 TGR 41..526 CDD:273624 256/487 (53%)
NADB_Rossmann 42..>77 CDD:304358 22/35 (63%)
FMT_C_like 126..>192 CDD:301347 27/67 (40%)
Pyr_redox 222..288 CDD:278498 34/66 (52%)
Pyr_redox_dim 398..507 CDD:280934 57/109 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H4701
Inparanoid 1 1.050 535 1.000 Inparanoid score I1141
OMA 1 1.010
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 1 1.000 T131189
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43256
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.