DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Txnrd1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001035988.1 Gene:Txnrd1 MGIID:1354175 Length:613 Species:Mus musculus

Alignment Length:489 Identity:250/490 (51%)
Similarity:331/490 (68%) Gaps:7/490 (1%)


  Fly    31 YDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASL 95
            ||:||:::||||.|||.|||||....:||..|:|.|||:||:||:||||||||||||||||||:|
Mouse   125 YDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAAL 189

  Fly    96 LGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHT 160
            ||:|:.::..|||.|:|| ::.||.|:..|||:||.|:||..||.||:|||.|.|:...|...|.
Mouse   190 LGQALKDSRNYGWKVEDT-VKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHR 253

  Fly   161 IEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGL 225
            |......|.| :..::|..::|.|.||||..|||..|..|:|||:||....||:||||||.||.|
Mouse   254 IVATNNKGKE-KIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVAL 317

  Fly   226 ECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIP---KAVERQADGRLL 287
            |||.||.|:|.:.|||||||:|||||:.|:..:...|.|.||.|:...:|   :.:|....|||.
Mouse   318 ECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLR 382

  Fly   288 VRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD--DKIVVDAAEATSVPHIFAVG 350
            |..::|.::......|:|||.|:||......:.|:..|||.::  .||.|...|.|:||:|:|:|
Mouse   383 VTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIG 447

  Fly   351 DIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADN 415
            ||:.|:.|||||||.:|||||:||:.||....||.:|.|||||||||.|.|:|||.|:|..|.:|
Mouse   448 DILEGKLELTPVAIQAGRLLAQRLYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEEN 512

  Fly   416 IEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVK 480
            |||:|.::.|.|:.:|.:....||.|.:..:..|::::|.|.:||.||||.||||||||.|||.:
Mouse   513 IEVYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQ 577

  Fly   481 TLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            .|.:|:||||..||.||.||:|||||.|...:.|
Mouse   578 QLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGC 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 22/37 (59%)
TGR 31..515 CDD:273624 250/490 (51%)
NADB_Rossmann <144..239 CDD:304358 45/95 (47%)
Pyr_redox 214..288 CDD:278498 39/77 (51%)
Pyr_redox_dim 388..497 CDD:280934 57/109 (52%)
Txnrd1NP_001035988.1 TGR 125..613 CDD:273624 250/490 (51%)
Pyr_redox 306..382 CDD:278498 39/76 (51%)
Pyr_redox_dim 485..595 CDD:280934 58/110 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.882 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.