DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and EID3

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001008395.1 Gene:EID3 HGNCID:32961 Length:333 Species:Homo sapiens

Alignment Length:168 Identity:36/169 (21%)
Similarity:54/169 (32%) Gaps:53/169 (31%)


  Fly   121 KLVRSVQ----NHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVV 181
            ||.||..    .|.|.|          :|:|...:|.|  ....::..:.|.|..:.|.....::
Human   176 KLERSAPKPRLEHQKKV----------RKMEENGNMPT--KLQKLDLSSYPEATEKNVERILGLL 228

  Fly   182 AVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIV 246
            ....| :|||.|.:....:...:.||      ||:                    |....|..||
Human   229 QTYFR-KYPDTPVSYFEFVIDPNSFS------RTV--------------------ENIFYVSFIV 266

  Fly   247 LRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADG 284
            ..||.|       ..:.|..:|.|.   |..|.:..:|
Human   267 RDGFAR-------IRLDEDRLPILE---PMNVNQMGEG 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358
TGR 31..515 CDD:273624 36/169 (21%)
NADB_Rossmann <144..239 CDD:304358 17/95 (18%)
Pyr_redox 214..288 CDD:278498 15/72 (21%)
Pyr_redox_dim 388..497 CDD:280934
EID3NP_001008395.1 Nse4-Nse3_bdg 89..137 CDD:317775
Nse4_C 240..328 CDD:312320 17/92 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.