DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and CG7430

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001262000.1 Gene:CG7430 FlyBaseID:FBgn0036762 Length:504 Species:Drosophila melanogaster

Alignment Length:515 Identity:141/516 (27%)
Similarity:232/516 (45%) Gaps:63/516 (12%)


  Fly     9 SSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKW 73
            ||||.|                   |:||:|.|..|...|.:||..|        :|...|..:.
  Fly    33 SSTHEA-------------------DIVVIGSGPGGYVAAIKAAQMG--------MKTVSVEKEA 70

  Fly    74 GIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDT-----NIRPDWRKLVRSVQNHIKSV 133
            .:||||:||||||.|     :||..:.:..:|:..:::..     ::..|..||:....|.:|::
  Fly    71 TLGGTCLNVGCIPSK-----ALLNNSHYYHMAHSGDLEKRGISCGSVSLDLEKLMGQKSNAVKAL 130

  Fly   134 NWVTRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGR-PRYPDIPGAVE 197
            .....:..:..||..:....|..:.:.:|.....|:. ..|.::.:::|.|.. ..:|.|....|
  Fly   131 TGGIAMLFKKNKVTQLTGFGTIVNPNEVEVKKSDGST-ETVKTKNILIATGSEVTPFPGIEIDEE 194

  Fly   198 LGITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVM--VRSIVLRGFDRQMSELLAA 260
            :.::|.......:.|...:|:|||.:|||.......||.|.|.:  :.:|...|.|.::|:....
  Fly   195 VIVSSTGALKLAKVPKHLVVIGAGVIGLELGSVWSRLGAEVTAIEFMDTIGGVGIDNEVSKTFQK 259

  Fly   261 MMTERGIPF-LGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAA 324
            ::|::|:.| |||.: .|..|..| .:.|...|..:........|.:|.::||:...|.|.|:|.
  Fly   260 VLTKQGLKFKLGTKV-TAASRSGD-NVTVSVENAKSGEKEEIQCDALLVSVGRRPYTEGLGLEAV 322

  Fly   325 G-VKTHDDKIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVA 388
            | ||....:|.|:|...|.||:|:|:||.|:| |.|...|...|.:....:..|...: ||..|.
  Fly   323 GIVKDDRGRIPVNATFQTVVPNIYAIGDCIHG-PMLAHKAEDEGLITIEGINGGHVHI-DYNCVP 385

  Fly   389 TTVFTPLEYSCVGMSEETAIELRGADNIEVFHGYYKPTEF-FIPQKSVR-----HCYLKAVAEVS 447
            :.|:|..|.:.||.||| .::..|.        .||..:| |:.....:     ..::|.:|:.:
  Fly   386 SVVYTHPEVAWVGKSEE-QLKQEGV--------AYKVGKFPFLANSRAKTNNDTDGFVKVLADQA 441

  Fly   448 GDQKILGLHYIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGR 507
            .| ||||.|.|||.|||:|.....|::.|...:.:......|||.:|.....::....|:
  Fly   442 TD-KILGTHIIGPGAGELINEAVLAMEYGAAAEDVARVCHAHPTCSEALREANVAAAFGK 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 11/39 (28%)
TGR 31..515 CDD:273624 136/494 (28%)
NADB_Rossmann <144..239 CDD:304358 23/96 (24%)
Pyr_redox 214..288 CDD:278498 24/77 (31%)
Pyr_redox_dim 388..497 CDD:280934 34/115 (30%)
CG7430NP_001262000.1 PRK06327 35..504 CDD:235779 139/514 (27%)
NADB_Rossmann 35..>74 CDD:304358 16/66 (24%)
Pyr_redox 211..290 CDD:278498 25/81 (31%)
Pyr_redox_dim 385..491 CDD:280934 34/116 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80087131
eggNOG 1 0.900 E1_COG1249
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D581771at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.