DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and dldh

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_958914.1 Gene:dldh ZFINID:ZDB-GENE-040120-4 Length:507 Species:Danio rerio

Alignment Length:501 Identity:127/502 (25%)
Similarity:219/502 (44%) Gaps:44/502 (9%)


  Fly    23 RLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPK 87
            |..|.:...|.|:.|:|.|..|...|.:||..|.:.:|        |.....:||||:||||||.
Zfish    31 RTYADKAAIDADVTVVGSGPGGYVAAIKAAQLGFKTVC--------VEKNATLGGTCLNVGCIPS 87

  Fly    88 KLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSM 152
            |.:...|.|....|........::...|..:..|::......:|::........:..||.:||..
Zfish    88 KALLNNSYLYHMAHGKDFESRGIEIQGISLNLEKMMAQKSGAVKALTGGIAHLFKQNKVTHVNGF 152

  Fly   153 ATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGR-PRYPDIPGAVELGITSDDIFSYEREPGRTL 216
            .|....:.:......|  .:.:.::.:::|.|.. ..:|.|....:..::|....|.:..|...:
Zfish   153 GTITGKNQVTAKTADG--EQVINTKNILIATGSEVTPFPGIEIDEDSVVSSTGALSLKNVPEELI 215

  Fly   217 VVGAGYVGLECACFLKGLGYEPTVM--VRSIVLRGFDRQMSELLAAMMTERGIPF-LGTTIPKAV 278
            |:|||.:|:|.....:.||.:.|.:  :..:...|.|.::|:....::.::|:.| |.|.:..|.
Zfish   216 VIGAGVIGVELGSVWQRLGAKVTAVEFLGHVGGMGIDMEISKNFQRILQKQGLKFKLSTKVMGAT 280

  Fly   279 ERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDK---IVVDAAEA 340
            :| .||::.|.........:.:...|.:|..|||:....:|.|::.|::.  ||   |.|:....
Zfish   281 KR-PDGKIDVAVEAAAGGKNETLTCDVLLVCIGRRPFTGNLGLESVGIEL--DKRGRIPVNGRFQ 342

  Fly   341 TSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEE 405
            |:||:|:|:||::.| |.|...|...|.:....:..|:..: ||..|.:.::|..|.:.||.:||
Zfish   343 TNVPNIYAIGDVVAG-PMLAHKAEDEGIICVEGMAGGAVHI-DYNCVPSVIYTHPEVAWVGKTEE 405

  Fly   406 TAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKI---------LGLHYIGPV 461
            ...| .|..        ||..:|.....|    ..|..|:..|..||         ||.|.:|..
Zfish   406 QLKE-EGVP--------YKVGKFPFAANS----RAKTNADTDGLVKILSHKDTDRMLGAHILGSG 457

  Fly   462 AGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGR 507
            |||:|...|.|::.|.:.:.:......|||.:|.|...::....|:
Zfish   458 AGEMINEAALAMEYGASCEDVARVCHAHPTVSEAFREANLAASFGK 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 11/39 (28%)
TGR 31..515 CDD:273624 125/494 (25%)
NADB_Rossmann <144..239 CDD:304358 21/96 (22%)
Pyr_redox 214..288 CDD:278498 20/77 (26%)
Pyr_redox_dim 388..497 CDD:280934 33/118 (28%)
dldhNP_958914.1 PRK06327 42..507 CDD:235779 124/491 (25%)
NADB_Rossmann 44..220 CDD:304358 43/186 (23%)
Pyr_redox 214..286 CDD:278498 20/73 (27%)
Glycosyltransferase_GTB_type <282..376 CDD:299143 28/98 (29%)
Pyr_redox_dim 388..494 CDD:280934 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D581771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.