DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and AIF

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_722765.2 Gene:AIF FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster

Alignment Length:555 Identity:108/556 (19%)
Similarity:190/556 (34%) Gaps:165/556 (30%)


  Fly    24 LAASRPRYDYDL------VVLGGGSAGLAC--AKEAAGCGARVLCFD------YVKPTPVGTKWG 74
            ||.|.|..: ||      :::|||:|..:.  |.::....|:||...      |::|.       
  Fly   241 LATSPPSSE-DLPKHVPYLIIGGGTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPP------- 297

  Fly    75 IGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNI--RPDWRKLVRSVQNHIKSVNWVT 137
                      :.|:|.:..:...:.:.:.....|...:.::  .||              ..::.
  Fly   298 ----------LSKELWYTPNPNEDPIKDYRFKQWTGSERSLFFEPD--------------EFFID 338

  Fly   138 RVDLRD--------------KKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPR 188
            ..||.|              |||:....:.|..|.:.|.|             :..::|.|..|:
  Fly   339 PEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEISY-------------DECLIATGCAPK 390

  Fly   189 Y--------PDIPGAVELGITSDDIFSYER------EPGRTLVVGAGYVGLECACFLK------- 232
            .        |.:...|.:..|.||   ::|      |.....:||.|::|.|.||.|.       
  Fly   391 NLPMLRDAPPSVLEKVMVYRTPDD---FDRLRKLAAEKRSITIVGNGFIGSELACSLAHYSRENN 452

  Fly   233 -GLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQA---DGRLLVRYRNT 293
             |..|: .....:.:.:.....:|....|.|..:|:    ..||.|..|.|   :..|.:...|.
  Fly   453 GGKVYQ-VFQENANMSKVLPNYLSRWTTAKMEAQGV----CVIPNASIRSAVRDETNLKLELNNG 512

  Fly   294 TTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDKIVVDA--------AEATSVPHIFAVG 350
            .|.|.     |.|:..:|...     |.|.||    ..::.||.        ||..:..:::..|
  Fly   513 MTLMS-----DVVVVCVGCTP-----NTDLAG----PSRLEVDRSLGGFVVNAELEARRNLYVAG 563

  Fly   351 DI------IYG--RPELTPVAILSGRLLARRLFAGST----QLMDYADVATTVFTPLEYSCVGMS 403
            |.      :.|  |.|....:::||||....:.....    |.|.::|:...:    .|..:|:.
  Fly   564 DASCFFDPLLGRRRVEHHDHSVVSGRLAGENMTGAKKPYQHQSMFWSDLGPEI----GYEGIGLV 624

  Fly   404 EET-------AIELRGADNIEVFHGYYKPTEFFIPQKSVRHCY-LKAVAEVSGDQKILGLHYIGP 460
            :.:       |:....|..::...   :.::..:|:.|..... .|:.|..|.|    |:.....
  Fly   625 DSSLPTVGVFALPSESATRVDQLS---ESSDSDVPETSTSSSQSSKSDAGASQD----GVTCDPD 682

  Fly   461 VAGEVIQGFAAALK----TGLTVKTLLNTVGIHPT 491
            .||...:|....||    .|:.:..|.|.:|:..|
  Fly   683 EAGNYGKGVIFYLKNDKIVGILLWNLFNRIGLART 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 13/53 (25%)
TGR 31..515 CDD:273624 104/549 (19%)
NADB_Rossmann <144..239 CDD:304358 27/117 (23%)
Pyr_redox 214..288 CDD:278498 20/85 (24%)
Pyr_redox_dim 388..497 CDD:280934 21/117 (18%)
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 71/382 (19%)
Pyr_redox 427..512 CDD:278498 21/90 (23%)
AIF_C 591..720 CDD:291391 24/139 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79741364
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.