DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Trxr-1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_727251.1 Gene:Trxr-1 FlyBaseID:FBgn0020653 Length:596 Species:Drosophila melanogaster

Alignment Length:487 Identity:374/488 (77%)
Similarity:428/488 (88%) Gaps:4/488 (1%)


  Fly    31 YDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTP-VGTKWGIGGTCVNVGCIPKKLMHQAS 94
            |||||:|:|||||||||||||...||||.|.|:||||| :|||||:|||||||||||||||||||
  Fly   113 YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQAS 177

  Fly    95 LLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSH 159
            |||||||||.|||||||: .|:|||.|||:||||||||||||||||||||||||:|.:.:|.|||
  Fly   178 LLGEAVHEAAAYGWNVDE-KIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSH 241

  Fly   160 TIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVG 224
            |:  :|...:..|.:|::..|:||||||||||||||||.||||||:||.:||||:||||||||:|
  Fly   242 TL--LAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIG 304

  Fly   225 LECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADGRLLVR 289
            ||||.||||||||||||||||||||||:||:||:||.|.|||||||..|:|.:||:|.||:|||:
  Fly   305 LECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVK 369

  Fly   290 YRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDKIVVDAAEATSVPHIFAVGDIIY 354
            |:|..|..:..||:||||||||||||::||||..|||....|||.||:.|||:|.:|:|||||||
  Fly   370 YKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIY 434

  Fly   355 GRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADNIEVF 419
            |:|||||||:|:||||||||:.||||.|||.||||||||||||:|||:|||.|::..|||.||||
  Fly   435 GKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVF 499

  Fly   420 HGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVKTLLN 484
            |||||||||||||||||:||||||||..|||::.|||||||||||||||||||||:|||:.||:|
  Fly   500 HGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLIN 564

  Fly   485 TVGIHPTTAEEFTRLSITKRSGRDPTPASCCS 516
            |||||||||||||||:||||||.|||||||||
  Fly   565 TVGIHPTTAEEFTRLAITKRSGLDPTPASCCS 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 29/37 (78%)
TGR 31..515 CDD:273624 372/485 (77%)
NADB_Rossmann <144..239 CDD:304358 65/95 (68%)
Pyr_redox 214..288 CDD:278498 58/74 (78%)
Pyr_redox_dim 388..497 CDD:280934 91/109 (83%)
Trxr-1NP_727251.1 TGR 113..595 CDD:273624 372/485 (77%)
NADB_Rossmann 115..>150 CDD:304358 27/35 (77%)
Pyr_redox 294..368 CDD:278498 58/74 (78%)
Pyr_redox_dim 468..577 CDD:280934 91/109 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131108235
eggNOG 1 0.900 E1_COG1249
Homologene 1 1.000 H4701
Inparanoid 1 1.050 264 1.000 Inparanoid score I926
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000402
orthoMCL 1 0.900 OOG5_126785
Panther 1 1.100 P PTHR43256
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R529
87.910

Return to query results.
Submit another query.