DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trxr-2 and CG4199

DIOPT Version :9

Sequence 1:NP_524216.1 Gene:Trxr-2 / 40475 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster


Alignment Length:372 Identity:83/372 - (22%)
Similarity:140/372 - (37%) Gaps:88/372 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VTSEYVVVAVGGRPRYPDIPG--------AVELGITSDDIFSYEREPGRTLVVGAGYVGLECACF 230
            |..:.:.:|.|.....|.|||        ..||..|...:.|...| .|.:.:|:.::.||.|..
  Fly   273 VKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPE-SRVVCLGSSFIALEAAAG 336

  Fly   231 LKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADGRLLVRYRNTTT 295
            |       ...|:|:.:.|  |:...|.||...|.|        .:.::...|.::::|..:...
  Fly   337 L-------VSKVQSVTVVG--RENVPLKAAFGAEIG--------QRVLQLFEDNKVVMRMESGIA 384

  Fly   296 QMDGSD---------VFDT----VLWAIGRKGLIEDLNLDAAGVKTHDDKI--VVDAAEATSVPH 345
            ::.|::         |.||    .|..:|....:....|..:|||.:.:..  |.|..| ::||.
  Fly   385 EIVGNEDGKVSEVVLVDDTRLPCDLLILGTGSKLNTQFLAKSGVKVNRNGSVDVTDFLE-SNVPD 448

  Fly   346 IFAVGDI----IYG----RPEL--TPVAILSGRLLARRLFAGSTQLMDYADVATTVF-TPLEYSC 399
            ::..|||    |:|    |..:  ..:|...||:.|..:..|..:|.......|.:| ..:.|:.
  Fly   449 VYVGGDIANAHIHGLAHDRVNIGHYQLAQYHGRVAAINMCGGVKKLEAVPFFFTLIFGKGIRYAG 513

  Fly   400 VGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGE 464
            .|..::..|:....|        :|...:||.:...    :.|||....|          |:..:
  Fly   514 HGSYKDVIIDGSMED--------FKFVAYFINEADT----VTAVASCGRD----------PIVAQ 556

  Fly   465 VIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTP 511
                ||..:..|   |.|.......|.|.|::     ||:.|: |.|
  Fly   557 ----FAELISQG---KCLGRGQIEDPATREDW-----TKKLGQ-PLP 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358
TGR 31..515 CDD:273624 83/372 (22%)
NADB_Rossmann <144..239 CDD:304358 18/72 (25%)
Pyr_redox 214..288 CDD:278498 16/73 (22%)
Pyr_redox_dim 388..497 CDD:280934 22/109 (20%)
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 49/210 (23%)
Pyr_redox 320..402 CDD:278498 19/98 (19%)
Reductase_C 505..577 CDD:291425 19/100 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.