DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Txnrd3

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001171641.1 Gene:Txnrd3 RGDID:1308363 Length:652 Species:Rattus norvegicus

Alignment Length:489 Identity:240/490 (49%)
Similarity:325/490 (66%) Gaps:7/490 (1%)


  Fly    31 YDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASL 95
            :||||:|:||||.||:||||||..|.:|:..|:|.|:|.||.||:||||||||||||||||||:|
  Rat   164 HDYDLIVIGGGSGGLSCAKEAANLGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAAL 228

  Fly    96 LGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHT 160
            ||.|:.:|..|||:.:. .::.:|..:..::||||.|:||..||.||:|.|.||||...|.:.|.
  Rat   229 LGHALQDARKYGWDYNQ-QVKHNWETMREAIQNHIGSLNWGYRVTLREKGVTYVNSFGEFVELHK 292

  Fly   161 IEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGL 225
            |:.....|.|.....|:: |:|.|.||||..|.|..|..|||||:||....||.||:|||.||||
  Rat   293 IKATNKKGQETFYTASKF-VIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGNTLIVGASYVGL 356

  Fly   226 ECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIP---KAVERQADGRLL 287
            |||.||.|||.:.||||||::|||||::|:|.:.:.:.::|:.|.....|   :.:|:...|||.
  Rat   357 ECAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGRLK 421

  Fly   288 VRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD--DKIVVDAAEATSVPHIFAVG 350
            |..::|.........::|||.||||......:.|:..|||.::  .||.|:..|.|:|||::|:|
  Rat   422 VVAKSTEGPETVEGTYNTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIG 486

  Fly   351 DIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADN 415
            |::.|:||||||||.:|:|||||||..|.:..||.:|.|||||||||.|.|:|||.|||:...:|
  Rat   487 DVLEGKPELTPVAIQAGKLLARRLFGISLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEMYTKEN 551

  Fly   416 IEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVK 480
            :||:|.::.|.|:.:..:....||.|.:.....:.:::|.|.:||.||||.||||||:|.|||.:
  Rat   552 LEVYHTFFWPLEWTVAGRDNNTCYAKIICNKFDNDRVIGFHLLGPNAGEVTQGFAAAMKCGLTKQ 616

  Fly   481 TLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            .|.:|:|||||..|.||.:.|||.||.|.|...|
  Rat   617 LLDDTIGIHPTCGEVFTTMEITKSSGLDITQKGC 650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 22/37 (59%)
TGR 31..515 CDD:273624 240/490 (49%)
NADB_Rossmann <144..239 CDD:304358 48/95 (51%)
Pyr_redox 214..288 CDD:278498 37/77 (48%)
Pyr_redox_dim 388..497 CDD:280934 53/109 (49%)
Txnrd3NP_001171641.1 GRX_GRXh_1_2_like 76..157 CDD:239511
NADB_Rossmann 163..>195 CDD:304358 19/31 (61%)
TGR 164..652 CDD:273624 240/490 (49%)
Pyr_redox 345..421 CDD:278498 37/76 (49%)
Pyr_redox_dim 524..634 CDD:280934 54/110 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.