DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and GSR

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_000628.2 Gene:GSR HGNCID:4623 Length:522 Species:Homo sapiens

Alignment Length:484 Identity:170/485 (35%)
Similarity:259/485 (53%) Gaps:44/485 (9%)


  Fly    33 YDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASLLG 97
            ||.:|:||||.|||.|:.||..|||....:..|         :|||||||||:|||:|...::..
Human    65 YDYLVIGGGSGGLASARRAAELGARAAVVESHK---------LGGTCVNVGCVPKKVMWNTAVHS 120

  Fly    98 EAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRD--SHT 160
            |.:|:...||:...:...  :||.:......::..:|.:.:.:|....:|.:...|.|..  ..|
Human   121 EFMHDHADYGFPSCEGKF--NWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPT 183

  Fly   161 IEYVAMPGAEHRQVTSEYVVVAVGGRPRYP---DIPGAVELGITSDDIFSYEREPGRTLVVGAGY 222
            ||      ...::.|:.::::|.||.|..|   .|||| .||||||..|..|..|||:::|||||
Human   184 IE------VSGKKYTAPHILIATGGMPSTPHESQIPGA-SLGITSDGFFQLEELPGRSVIVGAGY 241

  Fly   223 VGLECACFLKGLGYEPTVMVR-SIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADGRL 286
            :.:|.|..|..||.:.::|:| ..|||.||..:|......:...|:..|..:..|.|::...|..
Human   242 IAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLE 306

  Fly   287 LVRYRNTTTQMDG--------SDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDK--IVVDAAEAT 341
            :    :..|.:.|        .|| |.:||||||....:||:|:..|::| |||  |:||..:.|
Human   307 V----SMVTAVPGRLPVMTMIPDV-DCLLWAIGRVPNTKDLSLNKLGIQT-DDKGHIIVDEFQNT 365

  Fly   342 SVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFA-GSTQLMDYADVATTVFTPLEYSCVGMSEE 405
            :|..|:||||:. |:..||||||.:||.||.|||. .....:||.::.|.||:......||::|:
Human   366 NVKGIYAVGDVC-GKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTED 429

  Fly   406 TAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFA 470
            .||...|.:|::.:...:.|....:.::..: |.:|.|. .:.::|::|:|..|....|::||||
Human   430 EAIHKYGIENVKTYSTSFTPMYHAVTKRKTK-CVMKMVC-ANKEEKVVGIHMQGLGCDEMLQGFA 492

  Fly   471 AALKTGLTVKTLLNTVGIHPTTAEEFTRL 499
            .|:|.|.|.....|||.||||::||...|
Human   493 VAVKMGATKADFDNTVAIHPTSSEELVTL 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 17/35 (49%)
TGR 31..515 CDD:273624 170/485 (35%)
NADB_Rossmann <144..239 CDD:304358 37/100 (37%)
Pyr_redox 214..288 CDD:278498 24/75 (32%)
Pyr_redox_dim 388..497 CDD:280934 36/109 (33%)
GSRNP_000628.2 gluta_reduc_1 63..522 CDD:273614 170/485 (35%)
Pyr_redox 233..307 CDD:278498 24/74 (32%)
Pyr_redox_dim 412..520 CDD:280934 36/110 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S706
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R529
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.