DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Txnrd2

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_038739.2 Gene:Txnrd2 MGIID:1347023 Length:527 Species:Mus musculus

Alignment Length:510 Identity:264/511 (52%)
Similarity:351/511 (69%) Gaps:7/511 (1%)


  Fly     8 RSSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTK 72
            |..|....|.:.|  ..:|:..:..:||:|:||||.|||||||||..|.:|...|||:|:|.|||
Mouse    20 RPRTRALTRGTRG--AASAAGGQQSFDLLVIGGGSGGLACAKEAAQLGKKVAVADYVEPSPRGTK 82

  Fly    73 WGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVT 137
            ||:||||||||||||||||||:|||..:.:|..|||.|... ::.:|:.:..:||||:||:||..
Mouse    83 WGLGGTCVNVGCIPKKLMHQAALLGGMIRDAHHYGWEVAQP-VQHNWKTMAEAVQNHVKSLNWGH 146

  Fly   138 RVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYP-DIPGAVELGIT 201
            ||.|:|:||:|.|..|:|.|.||:..|. .|.:...:::|::|:|.||||||| .:.||:|.|||
Mouse   147 RVQLQDRKVKYFNIKASFVDEHTVRGVD-KGGKATLLSAEHIVIATGGRPRYPTQVKGALEYGIT 210

  Fly   202 SDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERG 266
            |||||..:..||:||||||.||.||||.||.|:|.:.|||:|||.|||||:|||.|:...|...|
Mouse   211 SDDIFWLKESPGKTLVVGASYVALECAGFLTGIGLDTTVMMRSIPLRGFDQQMSSLVTEHMESHG 275

  Fly   267 IPFLGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTH-- 329
            ..||...:|..:::....:|.|.:.:..:..:.:..||||||||||......|||:.||:.|:  
Mouse   276 TQFLKGCVPSHIKKLPTNQLQVTWEDHASGKEDTGTFDTVLWAIGRVPETRTLNLEKAGISTNPK 340

  Fly   330 DDKIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTP 394
            :.||:|||.||||||||:|:||:..|||||||.||.:|:|||:|||..|:.||||::|.||||||
Mouse   341 NQKIIVDAQEATSVPHIYAIGDVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMDYSNVPTTVFTP 405

  Fly   395 LEYSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIG 459
            |||.|||:|||.|:.|.|.:::||:|.||||.||.:..:....||:|.|......|.:||||::|
Mouse   406 LEYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLG 470

  Fly   460 PVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            |.||||.||||..:|.|.:...::.|||||||.:||..:|.|:||||.:||...|
Mouse   471 PNAGEVTQGFALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLEPTVTGC 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 22/39 (56%)
TGR 31..515 CDD:273624 259/488 (53%)
NADB_Rossmann <144..239 CDD:304358 50/96 (52%)
Pyr_redox 214..288 CDD:278498 37/74 (50%)
Pyr_redox_dim 388..497 CDD:280934 57/109 (52%)
Txnrd2NP_038739.2 TGR 43..527 CDD:273624 259/486 (53%)
NADB_Rossmann 43..>70 CDD:304358 18/27 (67%)
Pyr_redox 223..289 CDD:278498 36/66 (55%)
Pyr_redox_dim 399..508 CDD:280934 57/109 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 1 1.000
Homologene 1 1.000 H4701
Inparanoid 1 1.050 540 1.000 Inparanoid score I1159
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 1 1.000 T615813
orthoMCL 1 0.900 OOG5_126785
Panther 1 1.100 O PTHR43256
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.840

Return to query results.
Submit another query.