DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Txnrd3

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001171529.1 Gene:Txnrd3 MGIID:2386711 Length:652 Species:Mus musculus

Alignment Length:489 Identity:239/490 (49%)
Similarity:325/490 (66%) Gaps:7/490 (1%)


  Fly    31 YDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASL 95
            :||||:::||||.||:||||||..|.:|:..|:|.|:|.||.||:||||||||||||||||||:|
Mouse   164 HDYDLIIIGGGSGGLSCAKEAANLGKKVMVLDFVVPSPQGTTWGLGGTCVNVGCIPKKLMHQAAL 228

  Fly    96 LGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHT 160
            ||.|:.:|..|||..:. .::.:|..:..::|:||.|:||..||.||:|.|.||||...|.|.|.
Mouse   229 LGHALQDAKKYGWEYNQ-QVKHNWEAMTEAIQSHIGSLNWGYRVTLREKGVTYVNSFGEFVDLHK 292

  Fly   161 IEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGL 225
            |:.....|.|.....|:: |:|.|.||||..|.|..|..|||||:||....||.||||||.||||
Mouse   293 IKATNKKGQETFYTASKF-VIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGCTLVVGASYVGL 356

  Fly   226 ECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIP---KAVERQADGRLL 287
            |||.||.|||.:.||||||::|||||::|:|.:.:.:.::|:.|.....|   :.:|:...|:|.
Mouse   357 ECAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGKLK 421

  Fly   288 VRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD--DKIVVDAAEATSVPHIFAVG 350
            |..::|........:::|||.||||......:.|:..|||.::  .||.|:..|.|:|||::|:|
Mouse   422 VVAKSTEGPETVEGIYNTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIG 486

  Fly   351 DIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADN 415
            ||:.|:||||||||.:|:|||||||..|.:..||.::.|||||||||.|.|:|||.|||:...:|
Mouse   487 DILDGKPELTPVAIQAGKLLARRLFGVSLEKCDYINIPTTVFTPLEYGCCGLSEEKAIEMYKKEN 551

  Fly   416 IEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVK 480
            :||:|..:.|.|:.:..:....||.|.:.....:::::|.|.:||.|||:.||||||:|.|||.:
Mouse   552 LEVYHTLFWPLEWTVAGRDNNTCYAKIICNKFDNERVVGFHLLGPNAGEITQGFAAAMKCGLTKQ 616

  Fly   481 TLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            .|.:|:|||||..|.||.|.|||.||.|.|...|
Mouse   617 LLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGC 650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 21/37 (57%)
TGR 31..515 CDD:273624 239/490 (49%)
NADB_Rossmann <144..239 CDD:304358 50/95 (53%)
Pyr_redox 214..288 CDD:278498 37/77 (48%)
Pyr_redox_dim 388..497 CDD:280934 52/109 (48%)
Txnrd3NP_001171529.1 GRX_GRXh_1_2_like 76..157 CDD:239511
TGR 164..652 CDD:273624 239/490 (49%)
Pyr_redox 347..421 CDD:278498 36/74 (49%)
Pyr_redox_dim 524..634 CDD:280934 53/110 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.