DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and dld-1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001255810.1 Gene:dld-1 WormBaseID:WBGene00010794 Length:495 Species:Caenorhabditis elegans

Alignment Length:501 Identity:140/502 (28%)
Similarity:230/502 (46%) Gaps:64/502 (13%)


  Fly    32 DYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKK-LMHQASL 95
            |.||||:|||..|...|.:||..|.:.:|        |.....:||||:||||||.| |::.:..
 Worm    29 DADLVVIGGGPGGYVAAIKAAQLGMKTVC--------VEKNATLGGTCLNVGCIPSKALLNNSHY 85

  Fly    96 LGEAVHEAVAYGWNVDDT---NIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRD 157
            |..|.|:..|.|  :|.|   |:    .|::.:..|.:|.:....:...:..||.:|...||...
 Worm    86 LHMAQHDFAARG--IDCTASLNL----PKMMEAKSNSVKQLTGGIKQLFKANKVGHVEGFATIVG 144

  Fly   158 SHTIEYVAMPGAEHRQVTSEYVVVAVGGR-PRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAG 221
            .:|::.....|:. ..:.:..:::|.|.. ..:|.|....:..::|....|..:.|.:.:|:|||
 Worm   145 PNTVQAKKNDGSV-ETINARNILIASGSEVTPFPGITIDEKQIVSSTGALSLGQVPKKMVVIGAG 208

  Fly   222 YVGLECACFLKGLGYEPTVM--VRSIVLRGFDRQMSELLAAMMTERGIPFL-----------GTT 273
            .:|||.....:.||.|.|.:  :..:...|.|.::|:.....:|::|..||           |:|
 Worm   209 VIGLELGSVWQRLGAEVTAVEFLGHVGGMGIDGEVSKNFQRSLTKQGFKFLLNTKVMGASQNGST 273

  Fly   274 IPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD-DKIVVDA 337
            |...||...||      :..|.:.      ||:|.::||:...|.|.|....:...: .::.|:.
 Worm   274 ITVEVEGAKDG------KKQTLEC------DTLLVSVGRRPYTEGLGLSNVQIDLDNRGRVPVNE 326

  Fly   338 AEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGM 402
            ...|.||.|||:||:|.| |.|...|...|.|....: ||....:||..|.:.|:|..|.:.||.
 Worm   327 RFQTKVPSIFAIGDVIEG-PMLAHKAEDEGILCVEGI-AGGPVHIDYNCVPSVVYTHPEVAWVGK 389

  Fly   403 SEETAIELRGADNIEVFHGYYKPTEF-FIPQKSVR-----HCYLKAVAEVSGDQKILGLHYIGPV 461
            :|| .::..|.        .||..:| |:.....:     ..::|.:|:...| ::||:|.|||.
 Worm   390 AEE-QLKQEGV--------AYKIGKFPFVANSRAKTNNDQEGFVKVLADKQTD-RMLGVHIIGPN 444

  Fly   462 AGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGR 507
            |||:|.....|::.|.:.:.:......|||.:|.|...::....|:
 Worm   445 AGEMIAEATLAMEYGASAEDVARVCHPHPTLSEAFREANLAAYCGK 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 14/36 (39%)
TGR 31..515 CDD:273624 140/502 (28%)
NADB_Rossmann <144..239 CDD:304358 24/96 (25%)
Pyr_redox 214..288 CDD:278498 25/87 (29%)
Pyr_redox_dim 388..497 CDD:280934 32/115 (28%)
dld-1NP_001255810.1 PRK06327 27..486 CDD:235779 139/496 (28%)
NADB_Rossmann 29..>66 CDD:304358 16/45 (36%)
Pyr_redox 201..279 CDD:278498 22/78 (28%)
Pyr_redox_dim 375..481 CDD:280934 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D581771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.