DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and trxr-1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001294239.1 Gene:trxr-1 WormBaseID:WBGene00015553 Length:667 Species:Caenorhabditis elegans

Alignment Length:524 Identity:229/525 (44%)
Similarity:324/525 (62%) Gaps:23/525 (4%)


  Fly     4 IKFLRSSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTP 68
            :|.|::...:.|:.   |.|      .:.|||:|:||||.|||.||||:..|.:|.|.|:|||:|
 Worm   153 LKELKALKQDYLKE---WLR------DHTYDLIVIGGGSGGLAAAKEASRLGKKVACLDFVKPSP 208

  Fly    69 VGTKWGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSV 133
            .||.||:||||||||||||||||||||||.::|:|..|||.:.:..:...|..|..|||:||.|:
 Worm   209 QGTSWGLGGTCVNVGCIPKKLMHQASLLGHSIHDAKKYGWKLPEGKVEHQWNHLRDSVQDHIASL 273

  Fly   134 NWVTRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVEL 198
            ||..||.||:|.|.|:||...|.....|. ......:..::|::..:::.|.||:||:|||..|.
 Worm   274 NWGYRVQLREKTVTYINSYGEFTGPFEIS-ATNKKKKVEKLTADRFLISTGLRPKYPEIPGVKEY 337

  Fly   199 GITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMT 263
            .|||||:|.....||:||.|||.||.||||.||.|.|::.|||||||:|||||:.|:|.:...|.
 Worm   338 TITSDDLFQLPYSPGKTLCVGASYVSLECAGFLHGFGFDVTVMVRSILLRGFDQDMAERIRKHMI 402

  Fly   264 ERGIPFLGTTIPKAVER------QADGRLLV----RYRNTTTQMDGSDVFDTVLWAIGRKGLIED 318
            ..|:.| ...:|..:|:      :..|:..|    :...|....:.|:.::|:|.||||:.:.:|
 Worm   403 AYGMKF-EAGVPTRIEQIDEKTDEKAGKYRVFWPKKNEETGEMQEVSEEYNTILMAIGREAVTDD 466

  Fly   319 LNLDAAGVKTHDDKIVVDAAE-ATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLM 382
            :.|...||:....|.|:...| :|::|.::|:||::.|.||||||||.:||:|.||:|.|:.:|.
 Worm   467 VGLTTIGVERAKSKKVLGRREQSTTIPWVYAIGDVLEGTPELTPVAIQAGRVLMRRIFDGANELT 531

  Fly   383 DYADVATTVFTPLEYSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVR-HCYLKAVAEV 446
            :|..:.|||||||||.|.|:|||.|:...|.|||.::|..:.|.|:.|.::..: |||||.:...
 Worm   532 EYDQIPTTVFTPLEYGCCGLSEEDAMMKYGKDNIIIYHNVFNPLEYTISERMDKDHCYLKMICLR 596

  Fly   447 SGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTP 511
            :.::|::|.|.:.|.||||.|||..|||...........:|||||.||.||.|::.|:.|.:...
 Worm   597 NEEEKVVGFHILTPNAGEVTQGFGIALKLAAKKADFDRLIGIHPTVAENFTTLTLEKKEGDEELQ 661

  Fly   512 ASCC 515
            ||.|
 Worm   662 ASGC 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 22/39 (56%)
TGR 31..515 CDD:273624 223/496 (45%)
NADB_Rossmann <144..239 CDD:304358 40/95 (42%)
Pyr_redox 214..288 CDD:278498 35/80 (44%)
Pyr_redox_dim 388..497 CDD:280934 50/110 (45%)
trxr-1NP_001294239.1 TGR 173..667 CDD:273624 224/496 (45%)
Pyr_redox 353..426 CDD:278498 34/74 (46%)
Pyr_redox_dim 537..648 CDD:280934 51/111 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131108309
eggNOG 1 0.900 E1_COG1249
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 470 1.000 Inparanoid score I834
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 1 1.000 T375152
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.879 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.660

Return to query results.
Submit another query.