DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and trxr-2

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_498971.1 Gene:trxr-2 WormBaseID:WBGene00014028 Length:503 Species:Caenorhabditis elegans

Alignment Length:523 Identity:239/524 (46%)
Similarity:328/524 (63%) Gaps:31/524 (6%)


  Fly     1 MSTIKFLRSSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVK 65
            :||.|     .|..:|      ||.:|.   .:||:|:|.||.||:|:|.||..||.|...|.|:
 Worm     3 LSTFK-----RHLPIR------RLFSSN---KFDLIVIGAGSGGLSCSKRAADLGANVALIDAVE 53

  Fly    66 PTPVGTKWGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWN-VDDTNIRPDWRKLVRSVQNH 129
            |||.|..|||||||.|||||||||||||:::|:.:..|..|||| :|...|:.||..|.::|.:.
 Worm    54 PTPHGHSWGIGGTCANVGCIPKKLMHQAAIVGKELKHADKYGWNGIDQEKIKHDWNVLSKNVNDR 118

  Fly   130 IKSVNWVTRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQ----VTSEYVVVAVGGRPRYP 190
            :|:.||:.||.|..||:.|.|:.|.|.|.   :.:.:.|.:..:    :::..||::.|.||:||
 Worm   119 VKANNWIYRVQLNQKKINYFNAYAEFVDK---DKIVITGTDKNKTKNFLSAPNVVISTGLRPKYP 180

  Fly   191 DIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMS 255
            :|||| ||||||||:|:....||:||:||.|||.||||.||........|:||||.|:||||...
 Worm   181 NIPGA-ELGITSDDLFTLASVPGKTLIVGGGYVALECAGFLSAFNQNVEVLVRSIPLKGFDRDCV 244

  Fly   256 ELLAAMMTERGIPFLGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLN 320
            ..:...:...|:     .:.:.||.:....:..:.:.|.|...|.:.:|||:||.||...::.||
 Worm   245 HFVMEHLKTTGV-----KVKEHVEVERVEAVGSKKKVTFTGNGGVEEYDTVIWAAGRVPNLKSLN 304

  Fly   321 LDAAGVKT--HDDKIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMD 383
            ||.|||:|  ...||:.|..:..|...::|||||:..|.||||:||.||:|||.|||:.|.|::.
 Worm   305 LDNAGVRTDKRSGKILADEFDRASCNGVYAVGDIVQDRQELTPLAIQSGKLLADRLFSNSKQIVR 369

  Fly   384 YADVATTVFTPLEYSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQ-KSVRHCYLKAVAEVS 447
            :..||||||||||.|.||::||.||:..|.|:|||||.::.|.|:.:|| |....||:|||....
 Worm   370 FDGVATTVFTPLELSTVGLTEEEAIQKHGEDSIEVFHSHFTPFEYVVPQNKDSGFCYVKAVCTRD 434

  Fly   448 GDQKILGLHYIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTPA 512
            ..|||||||::||.|.|||||:|.|.:.|:::..|.||:.|||.::|||.:|.||||||:||...
 Worm   435 ESQKILGLHFVGPNAAEVIQGYAVAFRVGISMSDLQNTIAIHPCSSEEFVKLHITKRSGQDPRTQ 499

  Fly   513 SCC 515
            .||
 Worm   500 GCC 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 19/39 (49%)
TGR 31..515 CDD:273624 230/492 (47%)
NADB_Rossmann <144..239 CDD:304358 43/99 (43%)
Pyr_redox 214..288 CDD:278498 26/74 (35%)
Pyr_redox_dim 388..497 CDD:280934 60/110 (55%)
trxr-2NP_498971.1 TGR 19..503 CDD:273624 231/497 (46%)
NADB_Rossmann 20..>49 CDD:304358 15/29 (52%)
Pyr_redox 203..279 CDD:278498 27/81 (33%)
Pyr_redox_dim 374..484 CDD:280934 60/110 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4701
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 1 1.000 T375034
orthoMCL 1 0.900 OOG5_126785
Panther 1 1.100 O PTHR43256
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R529
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.