DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and gsr-1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001021220.1 Gene:gsr-1 WormBaseID:WBGene00008117 Length:473 Species:Caenorhabditis elegans

Alignment Length:500 Identity:189/500 (38%)
Similarity:277/500 (55%) Gaps:45/500 (9%)


  Fly    22 CRLAASRPRY----DYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNV 82
            |.|:.||...    ::|.:|:||||.|:|.|:.|...|..|...:..:         :|||||||
 Worm     6 CILSTSRSIMSGVKEFDYLVIGGGSGGIASARRAREFGVSVGLIESGR---------LGGTCVNV 61

  Fly    83 GCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVE 147
            ||:|||:|:..||..|.:.:...||::|  |..:.||:.:.:|...:||.:|.:....|:...||
 Worm    62 GCVPKKVMYNCSLHAEFIRDHADYGFDV--TLNKFDWKVIKKSRDEYIKRLNGLYESGLKGSSVE 124

  Fly   148 YVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREP 212
            |:...|||.:..|:|   :.||::|   .:..::||||:|..|:|.|| |.||.||..|..|..|
 Worm   125 YIRGRATFAEDGTVE---VNGAKYR---GKNTLIAVGGKPTIPNIKGA-EHGIDSDGFFDLEDLP 182

  Fly   213 GRTLVVGAGYVGLECACFLKGLGYEPTVMVR-SIVLRGFDRQMSELLAAMMTERGIPF---LGTT 273
            .||:||||||:.:|.|..|..||.:..:::| ..|||.||:.:|:.|.|.|.|...|.   ..|.
 Worm   183 SRTVVVGAGYIAVEIAGVLANLGSDTHLLIRYDKVLRTFDKMLSDELTADMDEETNPLHLHKNTQ 247

  Fly   274 IPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDK---IVV 335
            :.:.::.. ||.|.::   |||.:  .:...|::|||||..|.::|||:..||||  ||   |:|
 Worm   248 VTEVIKGD-DGLLTIK---TTTGV--IEKVQTLIWAIGRDPLTKELNLERVGVKT--DKSGHIIV 304

  Fly   336 DAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGST-QLMDYADVATTVFTPLEYSC 399
            |..:.||.|.|.:|||.. |:..||||||.:||.|:.|||.|.| ..:.|.::||.||:......
 Worm   305 DEYQNTSAPGILSVGDDT-GKFLLTPVAIAAGRRLSHRLFNGETDNKLTYENIATVVFSHPLIGT 368

  Fly   400 VGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGE 464
            ||::|..|:|..|.|.:.::...:.|..|.: .|......:|.|. |..|:|::|:|..|..:.|
 Worm   369 VGLTEAEAVEKYGKDEVTLYKSRFNPMLFAV-TKHKEKAAMKLVC-VGKDEKVVGVHVFGVGSDE 431

  Fly   465 VIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDP 509
            ::||||.|:..|.|.|....||.||||:|||.    :|.|.|..|
 Worm   432 MLQGFAVAVTMGATKKQFDQTVAIHPTSAEEL----VTMRGGVKP 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 12/43 (28%)
TGR 31..515 CDD:273624 185/491 (38%)
NADB_Rossmann <144..239 CDD:304358 41/95 (43%)
Pyr_redox 214..288 CDD:278498 29/78 (37%)
Pyr_redox_dim 388..497 CDD:280934 40/109 (37%)
gsr-1NP_001021220.1 PRK06116 19..467 CDD:235701 182/481 (38%)
Pyr_redox 184..261 CDD:278498 29/78 (37%)
Pyr_redox_dim 357..465 CDD:280934 40/114 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S706
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R529
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.