DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and DLD

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_000099.2 Gene:DLD HGNCID:2898 Length:509 Species:Homo sapiens

Alignment Length:506 Identity:123/507 (24%)
Similarity:227/507 (45%) Gaps:54/507 (11%)


  Fly    23 RLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPK 87
            |..|.:| .|.|:.|:|.|..|...|.:||..|.:.:|.:..:.        :||||:||||||.
Human    33 RTYADQP-IDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNET--------LGGTCLNVGCIPS 88

  Fly    88 KLMHQASLLGEAVHEAVAYGWN-----VDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVE 147
            |     :||..:.:..:|:|.:     ::.:.:|.:..|::......:|::........:..||.
Human    89 K-----ALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVV 148

  Fly   148 YVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGR-PRYPDIPGAVELGITSDDIFSYERE 211
            :||........:.:......|.. :.:.::.:::|.|.. ..:|.|....:..::|....|.::.
Human   149 HVNGYGKITGKNQVTATKADGGT-QVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKV 212

  Fly   212 PGRTLVVGAGYVGLECACFLKGLGYEPTVM-----VRSIVLRGFDRQMSELLAAMMTERGIPFLG 271
            |.:.:|:|||.:|:|.....:.||.:.|.:     |..:   |.|.::|:....::.::|..|..
Human   213 PEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV---GIDMEISKNFQRILQKQGFKFKL 274

  Fly   272 TTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD-DKIVV 335
            .|......:::||::.|.....:.........|.:|..|||:...::|.|:..|::... .:|.|
Human   275 NTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPV 339

  Fly   336 DAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCV 400
            :....|.:|:|:|:||::.| |.|...|...|.:....:..|:..: ||..|.:.::|..|.:.|
Human   340 NTRFQTKIPNIYAIGDVVAG-PMLAHKAEDEGIICVEGMAGGAVHI-DYNCVPSVIYTHPEVAWV 402

  Fly   401 GMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSG---------DQKILGLH 456
            |.|||...|    :.||     ||..:|.....|    ..|..|:..|         ..::||.|
Human   403 GKSEEQLKE----EGIE-----YKVGKFPFAANS----RAKTNADTDGMVKILGQKSTDRVLGAH 454

  Fly   457 YIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGR 507
            .:||.|||::...|.||:.|.:.:.:......|||.:|.|...::....|:
Human   455 ILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGK 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 12/39 (31%)
TGR 31..515 CDD:273624 120/499 (24%)
NADB_Rossmann <144..239 CDD:304358 20/96 (21%)
Pyr_redox 214..288 CDD:278498 18/79 (23%)
Pyr_redox_dim 388..497 CDD:280934 34/118 (29%)
DLDNP_000099.2 Pyr_redox_dim 43..509 CDD:332164 119/496 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D581771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.