DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Gsr

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_034474.4 Gene:Gsr MGIID:95804 Length:500 Species:Mus musculus

Alignment Length:481 Identity:172/482 (36%)
Similarity:262/482 (54%) Gaps:38/482 (8%)


  Fly    33 YDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASLLG 97
            :|.:|:||||.|||.|:.||..|||....:..|         :|||||||||:|||:|...::..
Mouse    43 FDYLVIGGGSGGLASARRAAELGARAAVVESHK---------LGGTCVNVGCVPKKVMWNTAVHS 98

  Fly    98 EAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDS--HT 160
            |.:|:.|.||:...:...  .|..:.:....::..:|.:.:.:|....:|.::..|||.|.  .|
Mouse    99 EFMHDHVDYGFQSCEGKF--SWHVIKQKRDAYVSRLNTIYQNNLTKSHIEIIHGYATFADGPRPT 161

  Fly   161 IEYVAMPGAEHRQVTSEYVVVAVGGRPRYP---DIPGAVELGITSDDIFSYEREPGRTLVVGAGY 222
            :|      ...::.|:.::::|.||.|..|   .|||| .||||||..|..|..|.|:::|||||
Mouse   162 VE------VNGKKFTAPHILIATGGVPTVPHESQIPGA-SLGITSDGFFQLEDLPSRSVIVGAGY 219

  Fly   223 VGLECACFLKGLGYEPTVMVR-SIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADGRL 286
            :.:|.|..|..||.:.::|:| ..|||.||..:|......:...|:..|..|..|.|::.:.|..
Mouse   220 IAVEIAGILSALGSKTSLMIRHDKVLRNFDSLISSNCTEELENAGVEVLKFTQVKEVKKTSSGLE 284

  Fly   287 L-----VRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDK--IVVDAAEATSVP 344
            |     |..|..||.|. .|| |.:||||||....:.|||:..|::| |:|  |:||..:.|:|.
Mouse   285 LQVVTSVPGRKPTTTMI-PDV-DCLLWAIGRDPNSKGLNLNKVGIQT-DEKGHILVDEFQNTNVK 346

  Fly   345 HIFAVGDIIYGRPELTPVAILSGRLLARRLF-AGSTQLMDYADVATTVFTPLEYSCVGMSEETAI 408
            .::||||:. |:..||||||.:||.||.||| ......:||.::.|.||:......||::|:.|:
Mouse   347 GVYAVGDVC-GKALLTPVAIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIGTVGLTEDEAV 410

  Fly   409 ELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAAL 473
            ...|.||::::...:.|....:..:..: |.:|.|. .:.::|::|:|..|....|::||||.|:
Mouse   411 HKYGKDNVKIYSTAFTPMYHAVTTRKTK-CVMKMVC-ANKEEKVVGIHMQGIGCDEMLQGFAVAV 473

  Fly   474 KTGLTVKTLLNTVGIHPTTAEEFTRL 499
            |.|.|.....|||.||||::||...|
Mouse   474 KMGATKADFDNTVAIHPTSSEELVTL 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 16/35 (46%)
TGR 31..515 CDD:273624 172/482 (36%)
NADB_Rossmann <144..239 CDD:304358 37/100 (37%)
Pyr_redox 214..288 CDD:278498 26/80 (33%)
Pyr_redox_dim 388..497 CDD:280934 36/109 (33%)
GsrNP_034474.4 gluta_reduc_1 42..500 CDD:273614 172/482 (36%)
Pyr_redox 211..287 CDD:278498 26/76 (34%)
Pyr_redox_dim 390..498 CDD:280934 36/110 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S706
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R529
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.