DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Dld

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_031887.2 Gene:Dld MGIID:107450 Length:509 Species:Mus musculus

Alignment Length:501 Identity:121/502 (24%)
Similarity:230/502 (46%) Gaps:44/502 (9%)


  Fly    23 RLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPK 87
            |..|.:| .:.|:.|:|.|..|...|.::|..|.:.:|.:..:.        :||||:||||||.
Mouse    33 RTYADQP-IEADVTVIGSGPGGYVAAIKSAQLGFKTVCIEKNET--------LGGTCLNVGCIPS 88

  Fly    88 KLMHQASLLGEAVHEAVAYGWN-----VDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVE 147
            |     :||..:.:..:|:|.:     ::...:|.:..|::....:.:|::........:..||.
Mouse    89 K-----ALLNNSHYYHMAHGKDFASRGIEIPEVRLNLEKMMEQKHSAVKALTGGIAHLFKQNKVV 148

  Fly   148 YVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGR-PRYPDIPGAVELGITSDDIFSYERE 211
            :||........:.:......|:. :.:.::.::||.|.. ..:|.|....:..::|....|.::.
Mouse   149 HVNGFGKITGKNQVTATKADGST-QVIDTKNILVATGSEVTPFPGITIDEDTIVSSTGALSLKKV 212

  Fly   212 PGRTLVVGAGYVGLECACFLKGLGYEPTVM-----VRSIVLRGFDRQMSELLAAMMTERGIPFLG 271
            |.:.:|:|||.:|:|.....:.||.:.|.:     |..|   |.|.::|:....::..:|..|..
Mouse   213 PEKLVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGI---GIDMEISKNFQRILQRQGFKFKL 274

  Fly   272 TTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDK--IV 334
            .|......:::||::.|.....:.........|.:|..|||:...::|.|:..|::. |.|  |.
Mouse   275 NTKVTGATKKSDGKIDVSVEAASGGKAEVITCDVLLVCIGRRPFTQNLGLEELGIEL-DPKGRIP 338

  Fly   335 VDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSC 399
            |:....|.:|:|:|:||::.| |.|...|...|.:....:..|:..: ||..|.:.::|..|.:.
Mouse   339 VNNRFQTKIPNIYAIGDVVAG-PMLAHKAEDEGIICVEGMAGGAVHI-DYNCVPSVIYTHPEVAW 401

  Fly   400 VGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQ---KILGLHYIGPV 461
            ||.|||...|    :.||...|.:   .|....::..:.....:.::.|.:   ::||.|.:||.
Mouse   402 VGKSEEQLKE----EGIEFKIGKF---PFAANSRAKTNADTDGMVKILGHKSTDRVLGAHILGPG 459

  Fly   462 AGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGR 507
            |||::...|.||:.|.:.:.:......|||.:|.|...::....|:
Mouse   460 AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAAAFGK 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 10/39 (26%)
TGR 31..515 CDD:273624 118/494 (24%)
NADB_Rossmann <144..239 CDD:304358 21/96 (22%)
Pyr_redox 214..288 CDD:278498 19/79 (24%)
Pyr_redox_dim 388..497 CDD:280934 30/112 (27%)
DldNP_031887.2 Pyr_redox_2 43..508 CDD:330998 118/491 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D581771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.