DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and Gsr

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_446358.2 Gene:Gsr RGDID:621747 Length:410 Species:Rattus norvegicus

Alignment Length:427 Identity:142/428 (33%)
Similarity:226/428 (53%) Gaps:35/428 (8%)


  Fly    90 MHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMAT 154
            |...::..|.:|:.|.||:  .:...:.:|..:......::..:|.:.:.:|....:|.::..||
  Rat     1 MWNTAVHSEFIHDHVDYGF--QNCKSKFNWHVIKEKRDAYVSRLNNIYQNNLTKSHIEVIHGYAT 63

  Fly   155 FRD--SHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYP---DIPGAVELGITSDDIFSYEREPGR 214
            |.|  ..|:|      ...::.|:.::::|.||.|..|   .|||| .||||||..|..|..|.|
  Rat    64 FADGPQPTVE------VNGKKFTAPHILIATGGVPTVPHENQIPGA-SLGITSDGFFQLEDLPSR 121

  Fly   215 TLVVGAGYVGLECACFLKGLGYEPTVMVR-SIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAV 278
            :::|||||:.:|.|..|..||.:.::|:| ..|||.||..:|......:...|:..|..:..|.|
  Rat   122 SVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRSFDSLISSNCTEELENAGVEVLKFSQVKEV 186

  Fly   279 ERQADGRLLVRYRNTTTQMDG--------SDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDK--I 333
            ::...|..|    :..|.:.|        .|| |.:||||||....:.|||:..|::| |||  |
  Rat   187 KKTPSGLEL----HVVTALPGRKPTVTTIPDV-DCLLWAIGRDPNSKGLNLNKLGIQT-DDKGHI 245

  Fly   334 VVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAG-STQLMDYADVATTVFTPLEY 397
            :||..:.|:|..::||||:. |:..||||||.:||.||.|||.| ....:||.::.|.||:....
  Rat   246 LVDEFQNTNVKGVYAVGDVC-GKALLTPVAIAAGRKLAHRLFEGKEDSRLDYDNIPTVVFSHPPI 309

  Fly   398 SCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVA 462
            ..||::|:.|:...|.||::::...:.|....:..:..: |.:|.|. .:.::|::|:|..|...
  Rat   310 GTVGLTEDEAVHKYGKDNVKIYSTAFTPMYHAVTTRKTK-CVMKMVC-ANKEEKVVGIHMQGIGC 372

  Fly   463 GEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRL 499
            .|::||||.|:|.|.|.....|||.||||::||...|
  Rat   373 DEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTL 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358
TGR 31..515 CDD:273624 142/428 (33%)
NADB_Rossmann <144..239 CDD:304358 37/100 (37%)
Pyr_redox 214..288 CDD:278498 25/75 (33%)
Pyr_redox_dim 388..497 CDD:280934 36/109 (33%)
GsrNP_446358.2 gluta_reduc_1 1..410 CDD:273614 142/428 (33%)
Pyr_redox 121..197 CDD:278498 25/80 (31%)
Pyr_redox_dim 300..408 CDD:280934 36/110 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126785
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.