DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and TXNRD3

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_443115.1 Gene:TXNRD3 HGNCID:20667 Length:643 Species:Homo sapiens

Alignment Length:491 Identity:242/492 (49%)
Similarity:329/492 (67%) Gaps:11/492 (2%)


  Fly    31 YDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASL 95
            |||||:::||||.||:||||||..|.:|:..|:|.|:|.||.||:||||||||||||||||||:|
Human   155 YDYDLIIIGGGSGGLSCAKEAAILGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAAL 219

  Fly    96 LGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHT 160
            ||:|:.::..:||..:. .:|.:|..:.:::||||.|:||..|:.||:|.|.||||...|.:.|.
Human   220 LGQALCDSRKFGWEYNQ-QVRHNWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHK 283

  Fly   161 IEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGL 225
            |:.....|.|.....::: |:|.|.||||..|.|..|..|||||:||....||:||||||.||.|
Human   284 IKATNKKGQETYYTAAQF-VIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVAL 347

  Fly   226 ECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIP---KAVERQADGRLL 287
            |||.||.|.|.:.|||||||:|||||::|:|.:.:.|.:.|:.||...||   :.:|:.:.|:|.
Human   348 ECAGFLAGFGLDVTVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLK 412

  Fly   288 VRYRNT--TTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD--DKIVVDAAEATSVPHIFA 348
            |..::|  |..::|  |::|||.||||......:.|:..|||.::  .||.|:..|.|:||:::|
Human   413 VLAKSTEGTETIEG--VYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYA 475

  Fly   349 VGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGA 413
            ||||:..:||||||||.||:|||:|||..|.:..||.:|.|||||||||.|.|:|||.|||:...
Human   476 VGDILEDKPELTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKK 540

  Fly   414 DNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLT 478
            :|:|::|..:.|.|:.:..:....||.|.:.......:::|.|.:||.||||.||||||:|.|||
Human   541 ENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAMKCGLT 605

  Fly   479 VKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            .:.|.:|:|||||..|.||.|.|||.||.|.|...|
Human   606 KQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGC 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 22/37 (59%)
TGR 31..515 CDD:273624 242/492 (49%)
NADB_Rossmann <144..239 CDD:304358 46/95 (48%)
Pyr_redox 214..288 CDD:278498 39/77 (51%)
Pyr_redox_dim 388..497 CDD:280934 52/109 (48%)
TXNRD3NP_443115.1 GRX_GRXh_1_2_like 67..148 CDD:239511
TGR 155..643 CDD:273624 242/492 (49%)
Pyr_redox 336..412 CDD:278498 39/76 (51%)
Pyr_redox_dim 515..625 CDD:280934 53/110 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.882 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.