DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and TXNRD2

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_006431.2 Gene:TXNRD2 HGNCID:18155 Length:524 Species:Homo sapiens

Alignment Length:498 Identity:274/499 (55%)
Similarity:352/499 (71%) Gaps:6/499 (1%)


  Fly    20 GWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGC 84
            |..|.||:..| ||||:|:||||.|||||||||..|.:|...|||:|:|.||:||:|||||||||
Human    28 GAARGAAAGQR-DYDLLVVGGGSGGLACAKEAAQLGRKVAVVDYVEPSPQGTRWGLGGTCVNVGC 91

  Fly    85 IPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYV 149
            |||||||||:|||..:.:|..|||.|... :..||||:..:||||:||:||..||.|:|:||:|.
Human    92 IPKKLMHQAALLGGLIQDAPNYGWEVAQP-VPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYF 155

  Fly   150 NSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYP-DIPGAVELGITSDDIFSYEREPG 213
            |..|:|.|.||:..||..|.| ..::::::::|.||||||| .|.||:|.||||||||..:..||
Human   156 NIKASFVDEHTVCGVAKGGKE-ILLSADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPG 219

  Fly   214 RTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAV 278
            :||||||.||.||||.||.|:|.:.|:|:|||.|||||:|||.::...|...|..||....|..|
Human   220 KTLVVGASYVALECAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRV 284

  Fly   279 ERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDD--KIVVDAAEAT 341
            .|..||:|.|.:.::||..:.:..||||||||||......|||:.|||.|..|  ||:||:.|||
Human   285 RRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREAT 349

  Fly   342 SVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEET 406
            |||||:|:||::.|||||||:||::||||.:|||.||:.||||.:|.|||||||||.|||:|||.
Human   350 SVPHIYAIGDVVEGRPELTPIAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEE 414

  Fly   407 AIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAA 471
            |:...|.:::||:|.:|||.||.:..:....||:|.|......|.:||||::||.||||.||||.
Human   415 AVARHGQEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLVLGLHFLGPNAGEVTQGFAL 479

  Fly   472 ALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            .:|.|.:...::.|||||||.:||..:|.|:||||.|||...|
Human   480 GIKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGLDPTVTGC 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 25/39 (64%)
TGR 31..515 CDD:273624 269/488 (55%)
NADB_Rossmann <144..239 CDD:304358 51/96 (53%)
Pyr_redox 214..288 CDD:278498 39/74 (53%)
Pyr_redox_dim 388..497 CDD:280934 55/109 (50%)
TXNRD2NP_006431.2 TGR 39..524 CDD:273624 269/487 (55%)
FMT_C_like 124..>190 CDD:301347 31/67 (46%)
Pyr_redox 220..295 CDD:278498 40/75 (53%)
Pyr_redox_dim 396..505 CDD:280934 55/109 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 1 1.000
Homologene 1 1.000 H4701
Inparanoid 1 1.050 551 1.000 Inparanoid score I1120
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 1 1.000 T608994
orthoMCL 1 0.900 OOG5_126785
Panther 1 1.100 O PTHR43256
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.