DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and txnrd1

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001243400.1 Gene:txnrd1 XenbaseID:XB-GENE-956002 Length:653 Species:Xenopus tropicalis

Alignment Length:516 Identity:248/517 (48%)
Similarity:331/517 (64%) Gaps:14/517 (3%)


  Fly     7 LRSSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGT 71
            |:.|..|..:..|........|..|||||:|:||||.|||.:||||..|.:||..|:|.|||:||
 Frog   142 LKLSKENLFQKLLETKEDNPDRSGYDYDLIVIGGGSGGLAASKEAANYGKKVLVLDFVTPTPLGT 206

  Fly    72 KWGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWV 136
            |||:||||||||||||||||||:||.:|:.::..|||.::| ||:.:|..:..||.|:|.|:|:.
 Frog   207 KWGLGGTCVNVGCIPKKLMHQAALLRQALKDSQKYGWQIED-NIQHNWEIMTDSVLNYIGSLNFN 270

  Fly   137 TRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGIT 201
            .||.|....|:|.|....|.:.|||:.....|.| :..|:|..::|.|.||||..|||..|..||
 Frog   271 YRVSLMQNNVKYENGYGEFVEPHTIKSTNSRGKE-KYFTAEKFLIATGERPRYLGIPGDKEYCIT 334

  Fly   202 SDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERG 266
            |||:||....||:||||||.||.||||.||.|||.:.|||||||:|||||:||:.::...|.|.|
 Frog   335 SDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDVTVMVRSILLRGFDQQMANMIGEYMEEHG 399

  Fly   267 IPFLGTTIP---KAVERQADGRLLVRYRNTTTQMDGSDV---FDTVLWAIGRKGLIEDLNLDAAG 325
            :.|:...:|   :.:|....|||.|    |:...||::.   ::|||.||||.....::.|:..|
 Frog   400 VKFIKQCVPTKIEQIEAGTPGRLKV----TSQASDGAETTEEYNTVLLAIGRDACTRNIGLEIPG 460

  Fly   326 VKTHD--DKIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVA 388
            ||.::  .||.|:..|.|:||:|:|:||::..:.|||||||.:||||||||:..||...||.:|.
 Frog   461 VKINEKTGKIPVNDEEQTNVPYIYAIGDVLQDKLELTPVAIQAGRLLARRLYGDSTVKCDYVNVP 525

  Fly   389 TTVFTPLEYSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKIL 453
            |||||||||...|:|||.||.....:||||:|.|:.|.|:.:|.:....||.|.:..:....:::
 Frog   526 TTVFTPLEYGACGLSEEHAIRQYEEENIEVYHSYFWPLEWTVPARDNNKCYAKIICNLKDKGRVV 590

  Fly   454 GLHYIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            |.|.:.|.|||:.||||.|:|.|||...|.||:||||..||.||.|::|||||.:...:.|
 Frog   591 GFHVLSPNAGEITQGFAVAIKCGLTKDQLDNTIGIHPVCAEIFTTLTVTKRSGGNILQSGC 651

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 24/39 (62%)
TGR 31..515 CDD:273624 243/493 (49%)
NADB_Rossmann <144..239 CDD:304358 47/95 (49%)
Pyr_redox 214..288 CDD:278498 40/77 (52%)
Pyr_redox_dim 388..497 CDD:280934 52/109 (48%)
txnrd1NP_001243400.1 Thioredoxin_like 73..153 CDD:294274 3/11 (27%)
TGR 166..653 CDD:273624 243/493 (49%)
Pyr_redox 347..423 CDD:278498 40/76 (53%)
Pyr_redox_dim 525..635 CDD:280934 53/110 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.