DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and dld

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_002933161.2 Gene:dld XenbaseID:XB-GENE-982851 Length:509 Species:Xenopus tropicalis

Alignment Length:495 Identity:125/496 (25%)
Similarity:218/496 (44%) Gaps:39/496 (8%)


  Fly    27 SRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMH 91
            |....:.|:.|:|.|..|...|.:||..|.:.:|        |.....:||||:||||||.|.:.
 Frog    36 SEKALEADVTVVGSGPGGYVAAIKAAQLGFQTVC--------VEKNDTLGGTCLNVGCIPSKALL 92

  Fly    92 QASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFR 156
            ..|.|....|........::.|.||.:..|::......:||:........:..||.:|.......
 Frog    93 NNSHLYHLAHGKDFASRGIEVTGIRLNLEKMMEQKSGAVKSLTTGIAHLFKQNKVVHVQGFGRIT 157

  Fly   157 DSHTIEYVAMPGAEHRQVTSEYVVVAVGGR-PRYPDIPGAVELGITSDDIFSYEREPGRTLVVGA 220
            ..:.:......|:. :.:.::.:::|.|.. ..:..||...|..::|....|.::.|.:.:|:||
 Frog   158 GKNQVTATKADGST-QVINTKNILIATGSEVAPFSGIPIDEETIVSSTGALSLKQVPEKMVVIGA 221

  Fly   221 GYVGLECACFLKGLGYEPTVM--VRSIVLRGFDRQMSELLAAMMTERGIPF-LGTTIPKAVERQA 282
            |.:|:|.....:.||.:.|.:  :..:...|.|.::|:....::.::|:.| |.|.:..|.:| .
 Frog   222 GVIGVELGSVWQRLGADVTAVEFLGHVGGLGIDMEISKNFQRILQKQGLKFKLNTKVTGATKR-P 285

  Fly   283 DGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHD-DKIVVDAAEATSVPHI 346
            ||::.|.........:.....|.:|..|||:...|:|.|...|::... .:|.:::...|.:|:|
 Frog   286 DGKIDVSIEAAAGGKEEVITCDVLLVCIGRRPYTENLGLQELGIELDSRGRIPINSRFQTKMPNI 350

  Fly   347 FAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELR 411
            :|:||::.| |.|...|...|.:....:..|:..: ||..|.:.::|..|.:.||.|||...| .
 Frog   351 YAIGDVVAG-PMLAHKAEDEGIICVEGMAGGAVHI-DYNCVPSVIYTHPEVAWVGKSEEQLKE-E 412

  Fly   412 GADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKI---------LGLHYIGPVAGEVIQ 467
            |.:        ||..:|.....|    ..|..|:..|..||         ||.|.:|..|||:|.
 Frog   413 GTE--------YKVGKFPFAANS----RAKTNADTDGLVKILSHKSTDRMLGAHILGAGAGEMIN 465

  Fly   468 GFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGR 507
            ..|.|::.|.:.:.:......|||.:|.|...::....|:
 Frog   466 EAALAMEYGASCEDVARVCHAHPTVSEAFREANLAASFGK 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 10/39 (26%)
TGR 31..515 CDD:273624 124/492 (25%)
NADB_Rossmann <144..239 CDD:304358 20/96 (21%)
Pyr_redox 214..288 CDD:278498 20/77 (26%)
Pyr_redox_dim 388..497 CDD:280934 34/118 (29%)
dldXP_002933161.2 NADB_Rossmann 26..>78 CDD:304358 13/50 (26%)
lipoamide_DH 43..508 CDD:273568 124/489 (25%)
Pyr_redox 215..288 CDD:278498 20/74 (27%)
Glycosyltransferase_GTB_type <284..378 CDD:299143 25/96 (26%)
Pyr_redox_dim 390..496 CDD:280934 34/119 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D581771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.