DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and gsr

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001120626.2 Gene:gsr XenbaseID:XB-GENE-997099 Length:590 Species:Xenopus tropicalis

Alignment Length:493 Identity:175/494 (35%)
Similarity:267/494 (54%) Gaps:55/494 (11%)


  Fly    29 PRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQA 93
            ||| :|.:|:||||.|||.|:.||..|||....:..|         :|||||||||:|||:|..|
 Frog   130 PRY-FDYLVVGGGSGGLASARRAAELGARTAVVESSK---------LGGTCVNVGCVPKKIMWNA 184

  Fly    94 SLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATF-RD 157
            ::..|.:|:...||:  :.:.|:..|:.:......::..:|.:.:.:|:..::|.:...|.| .|
 Frog   185 AIHSEYIHDHEDYGF--ETSAIKFTWKVIKEKRDAYVSRLNDIYQNNLQKAQIEIIRGQANFTSD 247

  Fly   158 SH-TIE-----YVAMPGAEHRQVTSEYVVVAVGGRPRYP---DIPGAVELGITSDDIFSYEREPG 213
            |. |:|     |:|           .::::|.||:|..|   ::||| .||||||..|.....|.
 Frog   248 SEPTVEVNGQKYIA-----------PHILIATGGKPSMPSDAEVPGA-SLGITSDGFFQLTDLPR 300

  Fly   214 RTLVVGAGYVGLECACFLKGLGYEPTVMVR-SIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKA 277
            |::||||||:.:|....|..||.:.::::| ..|||.||..:|......:...|:........|:
 Frog   301 RSVVVGAGYIAIEIVGILSALGSKASLLIRQDKVLRTFDSMISSNCTEELENAGVEVWKYAQVKS 365

  Fly   278 VERQADGRLLVRYRNTTTQMDG--------SDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDDK-- 332
            |::.|.|..:    |....|.|        .|| |.:||||||....|||.|:..|::. |:|  
 Frog   366 VKKSATGLEI----NVQCSMPGRKPTVRTIQDV-DCLLWAIGRDPNTEDLGLENLGLEL-DEKGH 424

  Fly   333 IVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAG-STQLMDYADVATTVFTPLE 396
            ||||..:.||...::||||:. ||..||||||.:||.|:.|||.| ....:||.::.|.||:...
 Frog   425 IVVDEFQNTSRKGVYAVGDVC-GRALLTPVAIAAGRKLSHRLFEGQEDSKLDYDNIPTVVFSHPP 488

  Fly   397 YSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPV 461
            ...||::||.|:..:|.:|::|:...:.|....:.::..: |.:|.|. |..::|::|||..|..
 Frog   489 IGTVGLTEEEAVTAKGRENVKVYTTSFSPMYHAVTRRKTK-CVMKLVC-VGKEEKVVGLHMQGLG 551

  Fly   462 AGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRL 499
            ..|::|||:.|:|.|.|.|...|||.||||::||...|
 Frog   552 CDEMLQGFSVAIKMGATKKDFDNTVAIHPTSSEELVTL 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 19/39 (49%)
TGR 31..515 CDD:273624 173/492 (35%)
NADB_Rossmann <144..239 CDD:304358 36/105 (34%)
Pyr_redox 214..288 CDD:278498 23/75 (31%)
Pyr_redox_dim 388..497 CDD:280934 39/109 (36%)
gsrNP_001120626.2 gluta_reduc_1 131..590 CDD:273614 174/493 (35%)
Pyr_redox 301..377 CDD:278498 24/80 (30%)
Pyr_redox_dim 480..588 CDD:280934 39/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.