DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and txnrd2

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001120487.2 Gene:txnrd2 XenbaseID:XB-GENE-5767949 Length:504 Species:Xenopus tropicalis

Alignment Length:488 Identity:278/489 (57%)
Similarity:354/489 (72%) Gaps:5/489 (1%)


  Fly    30 RYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQAS 94
            |:||||:|:||||.||||||:||..|.:|..||||:|:|.||||||||||||||||||||||||:
 Frog    17 RHDYDLLVIGGGSGGLACAKQAAQFGKKVAVFDYVEPSPRGTKWGIGGTCVNVGCIPKKLMHQAA 81

  Fly    95 LLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSH 159
            |:|..:.:|..|||:..: .|:.:|.|:.::|||::||:||..|:.|:||||:|.|..|:|.|.|
 Frog    82 LIGSTLKDAPHYGWDTPN-EIQHNWGKMAKAVQNYVKSLNWGHRIQLQDKKVKYFNMKASFVDEH 145

  Fly   160 TIEYVAMPGAEHRQVTSEYVVVAVGGRPRYP-DIPGAVELGITSDDIFSYEREPGRTLVVGAGYV 223
            .|..|...|.| ..||:|.:|:|.||||:|| .:|||:|.||||||:|..:..||:||||||.||
 Frog   146 CIRGVTKAGKE-TLVTAENIVIATGGRPKYPTHVPGALEYGITSDDLFWLKESPGKTLVVGASYV 209

  Fly   224 GLECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADGRLLV 288
            .||||.||.|:|.:...|||||.|||||:||:.|:...|...|..||....|..||:..:|:|.|
 Frog   210 SLECAGFLTGIGLDTAAMVRSIPLRGFDQQMAYLVTDYMELHGTKFLWKCTPSNVEKLKNGKLEV 274

  Fly   289 RYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDD--KIVVDAAEATSVPHIFAVGD 351
            .::||.:..:|:|::|||:||:||....:.|||:..||....|  ||:|:|:||||||||:|:||
 Frog   275 TWKNTESGKEGADIYDTVMWAVGRAAETQYLNLEKVGVDVKSDTGKIIVNASEATSVPHIYAIGD 339

  Fly   352 IIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADNI 416
            |..|||||||.||.:|:|||.|||:||.:||||..|.|||||||||.|||:|||.|.|..|.|||
 Frog   340 ITEGRPELTPTAIAAGKLLASRLFSGSAELMDYDSVPTTVFTPLEYGCVGISEEDAKERYGDDNI 404

  Fly   417 EVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVKT 481
            ||||.:|||.||.:.:::...||:|.:...:.||:|||||:.||.|||||||||..:|.|.|...
 Frog   405 EVFHAFYKPLEFIVAERNGSQCYIKIICLRTQDQRILGLHFTGPNAGEVIQGFALGIKCGATYHQ 469

  Fly   482 LLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514
            |:.|||||||.|||.|:|.||||||.|||...|
 Frog   470 LMRTVGIHPTCAEEVTKLHITKRSGLDPTVTGC 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 25/38 (66%)
TGR 31..515 CDD:273624 277/488 (57%)
NADB_Rossmann <144..239 CDD:304358 53/96 (55%)
Pyr_redox 214..288 CDD:278498 38/74 (51%)
Pyr_redox_dim 388..497 CDD:280934 65/109 (60%)
txnrd2NP_001120487.2 Pyr_redox_dim 18..504 CDD:332164 277/488 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1249
Hieranoid 1 1.000
Homologene 1 1.000 H4701
Inparanoid 1 1.050 579 1.000 Inparanoid score I941
OMA 1 1.010
OrthoDB 1 1.010 D164705at33208
OrthoFinder 1 1.000 FOG0000402
OrthoInspector 1 1.000 T600879
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R529
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.