DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ten-m and Tnxb

Sequence 1:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster
Sequence 2:XP_006525248.1 Gene:Tnxb MGIID:1932137 Length:4361 Species:Mus musculus

Alignment Length:2607 Identity:517/2608 (20%)
Similarity:814/2608 (31%) Gaps:970/2608 (37%)


  Fly  1069 QNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLR-- 1131
            :|||.|||..|:|..|.|.|:||:.|:|||...||..|...|...:|.|:|.||:.|::||.|  
Mouse   296 RNCPRGCSQRGRCEDGRCVCDPGYSGEDCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTC 360

  Fly  1132 ----------------------HDECEV----ADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHP 1170
                                  .|:|.|    .||:..|||..|:|.|..||.|..|....||. 
Mouse   361 PRDCRGRGRCEDGECICDAGYSGDDCGVRSCPGDCNQRGHCEDGRCVCWPGYTGADCSTRACPR- 424

  Fly  1171 NCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKE 1235
            :|.|.|.|.||.|:|..|:.|.||...     .|..||.|.|  :.::..|.|...::|.||...
Mouse   425 DCRGRGRCEDGVCVCHAGYSGEDCGVR-----SCPGDCRGRG--NCESGRCVCWPGYTGRDCGTR 482

  Fly  1236 LCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCP 1300
            .|..||...|||....|.|:|.:.||.|.:|.|...|..||.|:||.|:|..|::|..|:...||
Mouse   483 ACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGHCENGVCVCAVGYSGDDCSTRSCP 547

  Fly  1301 NSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVD-------------- 1351
            :.|.|.||| ::|    .|.|.||:.|.||||.   .|  .:|..:.|:..              
Mouse   548 SDCRGRGQC-LNG----LCECDEGYSGEDCGIR---RC--PRDCSQHGVCQDGLCMCHAGYAGED 602

  Fly  1352 ---------------CEDPECCASHVCK---TSQLCVSAPKPIDVLLR----------------- 1381
                           |||..|    ||.   |...|.:...|.|...|                 
Mouse   603 CSIRTCPADCRRRGRCEDGRC----VCNPGYTGPACATRTCPADCRGRGRCVQGVCMCYVGYSGE 663

  Fly  1382 ----KQPPAITA-------SFFERMKFLIDESSLQNYAKLETFNESIFWNYFNASRSAVIRGRVV 1435
                ::|||...       ......:.:..|........::|.....      .||...|:||.|
Mouse   664 DCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDC------RSRGECIQGRCV 722

  Fly  1436 TSLGMG-------LVGVRVSTTTLLEGFTL----TRDDGWFDLMVNGGGAVTLQFGRAPFRPQSR 1489
            ...|..       :..::.....|||..|:    ||..|..|       |..:|     |.|.:.
Mouse   723 CQEGYAGDDCGEEIPAIQNMRMHLLEETTVRTEWTRAPGPVD-------AYEIQ-----FIPMTE 775

  Fly  1490 IVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDL-MKPVVLASWKHGFQGACPDRSAIL 1553
            .|..|:...|...   .|..:::|||.       ..||.: ::.:...||.       |..|..:
Mouse   776 GVSPPFTARVPSS---ASAYDQRGLAP-------GQDYQVTVRALRGTSWG-------PPASKTI 823

  Fly  1554 AESQVIQESLQIPG---TGLNLVYHSSRA------AGYLST----IKLQLTPDVIPTSLHLIHLR 1605
            .......:.|::..   |.|:|.:...:|      ..|:|.    ::|::.|:...|.|      
Mouse   824 TTMIDGPQDLRVVAVTPTTLDLSWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADRTQL------ 882

  Fly  1606 ITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVT-TAVVKVG-----YQYTDC-------- 1656
                       .:..||:::.     :.:..:|.:.|: .|.::..     |.|.:.        
Mouse   883 -----------TDLMPGVEYV-----VTVTAERGHAVSYPASIRANTAPGHYSYPEVRPPAPPPN 931

  Fly  1657 ----------------TD---------------IVWDIQTTKLSGHDMSISEV------GGWNLD 1684
                            ||               ..|...||:||....::.::      .|:.|.
Mouse   932 PRPRPRWPSRPLPSPETDEKEWHLRPRLPQPPRRPWGNLTTELSRFRGTVQDLEHHLRTHGYPLR 996

  Fly  1685 IHHRY-----NFHEGILQKGDGSNIYLR---------NKPRIILTTMGDGHQRPLECPD------ 1729
            .:..|     ..||           :|:         ::||         |..|...|.      
Mouse   997 ANQTYASVARYIHE-----------FLKRHQTAGAPASQPR---------HPHPTTSPTQNTRKR 1041

  Fly  1730 ----------CDG--QATKQRLLAPVALAAAPDGSLFV------GDFNYI--------------R 1762
                      .||  ..|..|...|..|.:|.||||.|      |.|..:              .
Mouse  1042 DSEQGAVGPASDGAHPVTTARHPKPEVLGSAADGSLIVSLDGLRGQFERVVLRWRPLLPAKGPSG 1106

  Fly  1763 RIMTDGSIRTVVKLNATRVSYRYHMAL------------------------SPLDGTLYVSDP-- 1801
            .:..|||.|| |:|...|....||:.:                        |...|.|..:|.  
Mouse  1107 ELTVDGSERT-VRLPNLRPGTTYHVEVHGVRAGQTSKSYAFITTTTTTTTGSLPSGLLEATDEPP 1170

  Fly  1802 -----------------ESHQI--IRVRDTNDYSQPELNWEA------------VVGSG----ER 1831
                             |.|.:  ::|...:...:..:.|.|            .|..|    |.
Mouse  1171 PSGPSTTQGAQAPILILEHHPLGELKVLGRDKAGRLSVAWTAQPDSFAHFQLRMQVAEGPWAHEE 1235

  Fly  1832 CLPGDEAHC-----GDGA--------LAKDAKLAYP---KGI----------------------- 1857
            .||||....     ..||        :....|::.|   :||                       
Mouse  1236 LLPGDVQQALVPPPPPGAPYKLFLHGITPGGKISVPITYQGIMDRAQEQPGKPSVQPRLGELTVT 1300

  Fly  1858 AISSDNILYF-------ADGTNIRMVDRDG--------------------------IVSTLIGNH 1889
            .::||::|..       .|...|:..|:||                          |:..|||..
Mouse  1301 GLTSDSLLLHWTVPEGEFDSFLIQYKDKDGPQAISVEGPQRSTPISGLEPGRKYKFILYGLIGKK 1365

  Fly  1890 MHKSHWKPIPCEGTL------------KLEEMHLRWPTELAVSPMDNTLHI--------IDDHMI 1934
            .|    .|:..|..:            :|.|:   |.|:    |..::||:        .|..::
Mouse  1366 RH----GPLMAEAKILIQSDPDPGSPPRLGEL---WVTD----PTPHSLHLSWTVLGGQFDSFVV 1419

  Fly  1935 LRMTPDGRVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRV 1999
            .....:|:.||:   |:.                          ||...:.::..|..|..|..:
Mouse  1420 QYRDKEGQPRVV---PVE--------------------------GPDRSVVISPLDPNRKYRFTL 1455

  Fly  2000 IG--TDGRIAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRI 2062
            .|  ...|..|...         .|....|.:...:...:...:....|||||           :
Mouse  1456 FGIANKKRYGPLTA---------DGTTAAETKEESSEPPRLGELTVTGVTPDS-----------L 1500

  Fly  2063 RSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVT 2127
            |  :|......|...:.|...|.|        ||..|..  :.|:...|             ||.
Mouse  1501 R--LSWTVARGPFDSFVILYKDAQ--------GQPQSVP--IEGDENEV-------------TVP 1540

  Fly  2128 DAAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPT-------- 2184
            ....|:.:.:           |..|.:.|.|:..:.::.:.:.||..:.......|:        
Mouse  1541 GLESNRKYKM-----------NLYGLRGRQRVGPVSVVAKTAPPDVVDQPLSPPEPSTEAPEPPE 1594

  Fly  2185 -GLLR------TKLDSTGRSYVYNYDEFGRLT-------------------SAVTPTGRVIELSF 2223
             .|||      |..:|...|:..:..:|.:..                   ..||.:|...:..:
Mouse  1595 KPLLRELIVTDTTPNSLSLSWTVSEGQFDQFVIQYKNGDGQPKVVRVPGHEDQVTISGLEPDHKY 1659

  Fly  2224 DLSVKGAQVKVSENAQKEMSLLIQGATVIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYT 2288
            .:::.|.     .:.|:...:.:.|.|      |||.......:.||.:..|             
Mouse  1660 KMNLYGI-----HSGQRVGPVSVVGVT------AAEEEPPSPTEPSTEAPEP------------- 1700

  Fly  2289 ILAEQSPLLGE-------------SYPVPAKQRTEIAGDLAN-RFEWRYFVRRQQPLQAGKQSK- 2338
               .:.|||||             |:.||       .||..: ..:::....|.|.::.|.|.: 
Mouse  1701 ---TEEPLLGELTVTGSSPDSLSLSWTVP-------QGDFDSFTVQYKSSDGRPQVMRVGGQERE 1755

  Fly  2339 ------GPPR----------------PVTEVG----------------RKLRVNG--DNVLTLEY 2363
                  .|..                ||:.||                .:|.|.|  .|.::|.:
Mouse  1756 VIVRDLDPGHKYKMNLYGLHEGHRVGPVSTVGTTDKQPEEKPPLEPRLEELTVTGVTPNSVSLSW 1820

  Fly  2364 ---DRETQSVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEA 2425
               :.:..|.||...|:        |...|.:....:..:...:||:..|..::         ..
Mouse  1821 IVPEGQFDSFVVQYQDR--------DGQPREVPLTAEQREVTVLDLDPARIYKM---------NF 1868

  Fly  2426 YSFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVT-------TPRRSDYL---LQYDDAGALQS 2480
            |......|:       |...|.|..|.....|...|       .||..:..   :..|..|.|  
Mouse  1869 YGLHGRRRV-------GPLSVSAMTDSLSPAPAPATEASKLLPEPRLGELTVTDVTPDSVGLL-- 1924

  Fly  2481 LTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYND-EGQILAKIHPHQSGKVAFVHDTAGR 2544
            .|.|.|...:|::|                      |.| :||      ||              
Mouse  1925 WTVPEGEFDSFTVQ----------------------YKDRDGQ------PH-------------- 1947

  Fly  2545 LETILAGLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYKY 2609
            :.::.|.|.                ||..||.|..|::|:....::|     |.:.|..|...|.
Mouse  1948 VVSVAADLR----------------EVTIPGLEPSRKYKFLLFGVQD-----GKRRSQVSVEAKT 1991

  Fly  2610 A-YDGNA-----RLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQF 2668
            | :|..:     ||.  |:.:.|....:.|..::             :....|:..|:|...|..
Mouse  1992 ATHDDTSPGAPPRLG--ELWVTDPTTDSLRLSWT-------------VPEGHFDSFVVQFKDKSG 2041

  Fly  2669 FAIVDYDQHGRVKSVLMNVKNIDV---FRLELDYDLRNRIKSQKTTFGRSTAFDKIN--YNADGH 2728
            ..:|......|..::..    :|.   :|..| |.|..|.:     ||..|| :.|.  .||..|
Mouse  2042 PRVVPVKGQERTATITA----LDAGRKYRFLL-YGLLGRKR-----FGPLTA-EGITEPTNAADH 2095

  Fly  2729 VVEVLGTNNWKYLFDENGNTVGVVD--------QGEKFNLGYDIGDRVIKVGDVEFNNYDARGFV 2785
            ....||..     ....|.|...||        |.:.|.:.|...|...:|..|:.::.:.|...
Mouse  2096 TKSRLGEE-----LRVTGVTQNSVDLSWTVSEGQFDSFVVQYKDRDGQSQVVPVDGSHREVRVSG 2155

  Fly  2786 VKRGEQKYRYNNRGQLIHSFERER----FQSWYYYDDRSRLVAWHDNKGNTTQYYYANPR----- 2841
            :..| ::|:.     |::.....:    .......|.|....||  .:..||....|.||     
Mouse  2156 LDPG-RRYKL-----LLYGLRDSKRVGPLSVIAVTDPRETTEAW--TEVPTTSTPAAVPRLGELR 2212

  Fly  2842 ----TPH------LVTHVHFPKISRTMKLFYDDRD--MLIALEHEDQ------------RYYVAT 2882
                |||      :||...|    .:.::.|.|||  :.:|....||            ||.:..
Mouse  2213 VEEATPHSLHLSWVVTEGEF----NSFEVQYTDRDGQLRVASTEGDQTDITLTGLESNHRYLITL 2273

  Fly  2883 --DQNGSPLAFFDQNGSIVKEMKRTPFGRIIKD---TKPEFFVPIDFHGGLIDPHTKLVYTEQRQ 2942
              ..:|.|:      ||...|....|:....::   |:|....|                 |.| 
Mouse  2274 YGFHDGQPV------GSAQIEALTVPWEEEEEEEESTEPPTMTP-----------------EPR- 2314

  Fly  2943 YDPHVGQW----MTPLWETLATEMSHPT---DVFIYRYHNND--------PINPNKPQNYMIDLD 2992
              |.:|:.    .||  ::|:...:.|.   |.|:.:|.|.|        |.:.::.....::.|
Mouse  2315 --PQLGELTVTDATP--DSLSLSWTVPEGQFDQFVIQYKNGDGQPKVVRVPGHEDQVTISGLEPD 2375

  Fly  2993 SWLQLFGYDLNNMQ-----SSRYTKLAQYTPQASIKSNTLAPD------FGVIS---------GL 3037
            ...:|..|.:::.|     |:.....|...|.:..:.:|.||:      .|.::         .|
Mouse  2376 HKYKLNLYGIHSGQRFGPVSTVGVTAAVEEPPSPTEPSTEAPEPTEEPLLGELTVTGSSPDSLSL 2440

  Fly  3038 ECIV-----EKTSEKFSDFDFVPKPL----LKMEPKMRNLLPRVSYRRGVFG--EGVLLSRIGGR 3091
            ...|     :..:.::.|.|..|:.:    .:.|..:|:|.|...|:..::|  ||   .|:|..
Mouse  2441 SWTVPQGDFDSFTVQYKDSDGRPQVMRVGGQEREVIVRDLDPGRKYKMNLYGLHEG---RRVGPV 2502

  Fly  3092 ALVSVVD 3098
            :.|.|.|
Mouse  2503 STVGVTD 2509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 59/157 (38%)
CRD2 1106..1151 CDD:276900 20/73 (27%)
EGF_2 1139..1162 CDD:285248 11/23 (48%)
Keratin_B2 1162..1330 CDD:279797 64/168 (38%)
EGF_2 1167..1194 CDD:285248 13/27 (48%)
DUF3844 1171..>1235 CDD:289707 22/64 (34%)
EGF_2 <1272..1294 CDD:285248 10/22 (45%)
NHL 1750..2065 CDD:302697 82/490 (17%)
NHL repeat 1784..1830 CDD:271320 13/107 (12%)
NHL repeat 1854..1888 CDD:271320 15/93 (16%)
NHL repeat 1911..1950 CDD:271320 9/47 (19%)
NHL repeat 1972..2005 CDD:271320 6/35 (17%)
NHL repeat 2039..2065 CDD:271320 6/26 (23%)
RHS_repeat 2183..2218 CDD:283287 11/69 (16%)
RhsA 2347..3020 CDD:225750 151/782 (19%)
YD_repeat_2x 2795..2836 CDD:273728 7/45 (16%)
Rhs_assc_core 2905..2980 CDD:274730 18/93 (19%)
Tox-GHH 3193..3268 CDD:292269
TnxbXP_006525248.1 Keratin_B2 144..333 CDD:279797 19/37 (51%)
EGF_2 172..200 CDD:285248
EGF_2 203..231 CDD:285248
EGF_2 <240..262 CDD:285248
EGF_2 <271..293 CDD:285248
EGF_2 <302..324 CDD:285248 11/22 (50%)
EGF_2 332..355 CDD:285248 8/23 (35%)
EGF_2 355..386 CDD:285248 4/31 (13%)
EGF_2 389..417 CDD:285248 11/28 (39%)
EGF_2 417..448 CDD:285248 14/32 (44%)
EGF_2 451..479 CDD:285248 9/35 (26%)
EGF_2 482..510 CDD:285248 11/28 (39%)
EGF_2 516..541 CDD:285248 10/25 (40%)
EGF_2 541..572 CDD:285248 15/36 (42%)
EGF_2 608..634 CDD:285248 7/30 (23%)
EGF_2 639..665 CDD:285248 3/26 (12%)
EGF_2 704..732 CDD:285248 8/34 (24%)
fn3 737..818 CDD:278470 24/110 (22%)
fn3 828..906 CDD:278470 15/100 (15%)
fn3 <1107..1138 CDD:278470 10/32 (31%)
fn3 1295..1369 CDD:278470 13/78 (17%)
FN3 1386..1466 CDD:238020 19/116 (16%)
fn3 1484..1557 CDD:278470 21/120 (18%)
fn3 1599..1676 CDD:278470 10/82 (12%)
fn3 1707..1777 CDD:278470 12/77 (16%)
fn3 1804..1873 CDD:278470 15/86 (17%)
fn3 1909..1971 CDD:278470 23/122 (19%)
fn3 2000..2067 CDD:278470 13/86 (15%)
fn3 2102..2164 CDD:278470 13/68 (19%)
FN3 2211..2279 CDD:238020 15/72 (21%)
fn3 2315..2395 CDD:278470 16/82 (20%)
fn3 2426..2496 CDD:278470 13/70 (19%)
fn3 2525..2602 CDD:278470
fn3 2639..2709 CDD:278470
fn3 2748..2825 CDD:278470
fn3 2861..2931 CDD:278470
fn3 2970..3045 CDD:278470
fn3 3076..3146 CDD:278470
fn3 3183..3260 CDD:278470
fn3 3291..3361 CDD:278470
fn3 3387..3449 CDD:278470
fn3 3480..3542 CDD:278470
fn3 3569..3649 CDD:278470
fn3 3679..3752 CDD:278470
fn3 3776..3855 CDD:278470
FN3 3876..3955 CDD:238020
fn3 3963..4035 CDD:278470
FN3 4052..4136 CDD:238020
Fibrinogen_C 4143..4352 CDD:278572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.