DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ten-m and tenm1

Sequence 1:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster
Sequence 2:XP_691552.5 Gene:tenm1 ZFINID:ZDB-GENE-060531-26 Length:2721 Species:Danio rerio

Alignment Length:2840 Identity:880/2841 (31%)
Similarity:1376/2841 (48%) Gaps:385/2841 (14%)


  Fly   686 DLMMNDASHYEDIDIVKLDGLTISHEEEIYKTADKENMAPKNQPSQHIDRSQNEVLKGHQQGDEK 750
            :|..:.:|..||      ..|...|..|.:..||.|       |.:....:.::|        .:
Zfish    17 ELSYSSSSEEED------GNLHHKHYRETHIRADYE-------PDRRFTYNSHKV--------RR 60

  Fly   751 QPQLEPLKPYVSERVDLPGKRIF---------LNLTIATDEGSDSVYTLHVEVPTGGGP-HFIKE 805
            :|..:|.|.:..     |.:.:|         .|..:|...|..:......|...|..| |.:: 
Zfish    61 KPLEQPQKDFSD-----PSQTVFPDFQTELHAANQELAYPGGVSAGVPSDPESEGGASPDHALR- 119

  Fly   806 VLTHEKPTAQADSCV------------------------------------PEPPPRMPDCPCSC 834
             |..::..::..||:                                    |.|||..|...|:|
Zfish   120 -LWMQEVKSEHSSCLSSRANSVLSLTDTEQERKSEPENDLPSSPVAQFTFRPLPPPPPPPHACTC 183

  Fly   835 L-PPPAPIYLDDTVDIDSAPPAKTVTTSTISAPINPFHSEEEDDEDGVRDEEQTP---------- 888
            . |.|||:             .:.|..||:.|...|..|..:..:|   |..||.          
Zfish   184 ARPAPAPL-------------PEVVQRSTLPARCQPLDSGNKAGQD---DNGQTHNTWALNSNIP 232

  Fly   889 ---------------------------SSSTATN-----LPSTEIDNHIAAFTEP---------A 912
                                       :|||..:     ||.|.:...:.:|::|         |
Zfish   233 LETRHFLFKHGSGSSAIFNAANQNYPLTSSTVYSPPPRPLPRTTLSRPLFSFSKPYRCCNWKCTA 297

  Fly   913 VGAGGVPFACPDVMPVLI-----------------------------LEGAR-TFPARSFPPDGT 947
            :.|..:......::..:|                             |.||. ||.....|...|
Zfish   298 LSASAITLTLALLLTYIIVVHLLGLPWHLKRVEGELYENGMSKEDQPLPGADFTFTPVHLPGLNT 362

  Fly   948 T--------------FGQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGVYGRR 998
            |              .|::.:|.:|.:.|.|..:|........|.||||:.::.|.|.:|:||||
Zfish   363 TQPDKEVIQRGRVIERGEVAVGTQLVQAIPPGLFWRFHITVHHPEYVKFNISLTRDALLGIYGRR 427

  Fly   999 NALPTHTQYHFKEVLSG---FSASTRTA-------RAAHLSITREV--TRYMEPGHWFVSLYNDD 1051
            |..|||||:.|.::|.|   ....:|..       |:..:|..:|.  ..|::.|.|:::.|||.
Zfish   428 NIPPTHTQFDFVKLLDGRQLIKQDSRNVKSPIAPPRSLLMSALQETGFVEYLDVGTWYLAFYNDG 492

  Fly  1052 GDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGE 1116
            ..::::..|:...|.: ..|...|:|||:|:.|||.|..||.|.|||:..||||||.:|:|..|.
Zfish   493 RKMEQVVVYSTPIETI-DGCSTNCNGNGECVAGHCHCFTGFLGPDCSKDSCPVLCSGNGDYEKGV 556

  Fly  1117 CICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADG 1181
            |:|:.||||.||.:...:|....||.:|.||:|.|.|...:||..||:|||..|.|||.|.|..|
Zfish   557 CVCHTGWKGAECEVEEGQCIDPTCSNNGECVNGACVCAPAFKGDNCEQVDCKDPLCSGRGVCVRG 621

  Fly  1182 TCICKKGWKGPDCATMDQDAL-QCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHG 1245
            .|:|..||.|..|.|    || .|...||||||:...|..|.||..|||:||:.|:|.:.|..|.
Zfish   622 ECVCSAGWGGESCET----ALPACKEQCSGHGTYQTQTGGCVCEQGWSGEDCAIEVCPVPCSPHS 682

  Fly  1246 RCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTI----------EGCP 1300
            .|....|.|:..|.|..|:.:.|...|.|||:|::|.|:|..||.|:||||          :.||
Zfish   683 VCVAGRCQCEEGWEGTTCDKQPCHPICEEHGECRDGQCVCQPGWEGEHCTIAAHYLDLFDKDACP 747

  Fly  1301 NSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKT 1365
            ..|.|:|:|.:...| |.|.|..||.||.|.:.:|..|.||||||.|||:||.||:||:..||.:
Zfish   748 GLCNGNGRCTLEQSG-WHCVCQSGWSGPGCNVVMETECNDSKDNDSDGLMDCVDPDCCSQQVCAS 811

  Fly  1366 SQLCVSAPKPIDVLLRKQPPAIT---ASFFERMKFLIDESSLQNY-AKLETFNESIFWNYFNASR 1426
            :.||..:|.|.|::.:......|   ..||||::|||...|.... ..|.          |::||
Zfish   812 APLCQGSPDPRDIIQQSHTSYETRPSRQFFERVRFLIGRDSTHILPGDLP----------FDSSR 866

  Fly  1427 SAVIRGRVVTSLGMGLVGVRVSTTTLLE-GFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRPQSRI 1490
            ..||||:|:.|.|..||||.|:.....| |:||:|.||.|||:..||.:|:|.|.||||..|.|.
Zfish   867 VCVIRGQVLASDGTPLVGVNVTFQHNPEYGYTLSRQDGSFDLLAVGGISVSLVFQRAPFLSQIRS 931

  Fly  1491 VQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKP--VVLASWKHGFQGACPDRSAIL 1553
            |.:|||:.:::|.|.|..:|.|      |..|...  :|:.|  |||::....|...|.:|.|:|
Zfish   932 VWLPWNQFMVLDRVFMERTESK------TPVCDLK--NLISPHAVVLSAPLPRFAADCEERGAVL 988

  Fly  1554 AESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFE 1618
            .|.|.:||.:.||.|.|.|.|.||||.||.|.:::.||...:|..|..:||.:.::|....:.|.
Zfish   989 PELQAVQEEVVIPATVLKLSYLSSRAPGYRSLLRVVLTHSTLPLGLAKVHLSVAVQGRQLLKSFP 1053

  Fly  1619 ADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIV-WDIQTTKLSGHDMSISEVGGWN 1682
            |.|.:.:.::||:.:||.|:|.|:..|.|.|||:|..|.|:| |:.:..:|.|.::..|.:|||.
Zfish  1054 AAPNLIYVFSWNKTDIYGQQVTGLVQAHVSVGYEYESCLDVVLWEKRVAQLQGFELMPSNLGGWT 1118

  Fly  1683 LDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGDGHQRPLECPDCDGQATKQRLLAPVALAA 1747
            |:.||..|...|||.||:|.|:::..:|.:|.|.||.|..|.:.||:|:|.|.:|:|.||:|||.
Zfish  1119 LNHHHVLNLESGILHKGNGENVFISQQPLVISTVMGTGVVRAIPCPNCNGPAVEQKLFAPIALAC 1183

  Fly  1748 APDGSLFVGDFNYIRRIMTDGSIRTVVKL------NATRVSYRYHMALSPLDGTLYVSDPESHQI 1806
            ..|||::||||||||||:.:|...::::|      :::..:::|::::.|:..:||:||..|.::
Zfish  1184 GSDGSVYVGDFNYIRRILPNGFAISILELRNRDIRHSSSPAHKYYLSMDPVRESLYLSDTSSGKL 1248

  Fly  1807 IRVRDTNDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGT 1871
            .|::...:......|.|.|.||||:|.|.....||||..|.:|.|:.|:|||:.....:||.||:
Zfish  1249 YRLKTLTEPKDLSRNVEVVAGSGEQCTPFHPNQCGDGGKATEAALSNPRGIAVDKHGFIYFVDGS 1313

  Fly  1872 NIRMVDRDGIVSTLIGNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILR 1936
            .||.:|..|:::|:||::...|. :||.|:..:.:.::.|.|||:|||||:||:|:::|::::|:
Zfish  1314 TIRKIDDKGVITTIIGSNGLTSS-QPISCDSRMDISQVRLEWPTDLAVSPLDNSLYVLDNNLVLQ 1377

  Fly  1937 MTPDGRVRVISGRPLHCATAS--TAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRV 1999
            ::...:|||::|||:||..||  .......|..:.|...::||....|.||:||:|.::.:||:.
Zfish  1378 VSESQQVRVVAGRPIHCPMASIEPVLLGKTAVRSVLEGAKAIAVSHQGTLYIAETDDRKHSRVQE 1442

  Fly  2000 IGTDGRIAPFAGAESKCNC-LERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIR 2063
            :.|:|.:...|||.|:|:| ::..|:||..:...|..||..:.::|||:|:..:.|||..|.|||
Zfish  1443 VSTNGEMVIIAGATSECDCKIDPNCECFSGDGGYARDAKLKSPSSLAVSPNGSLCIADLGNVRIR 1507

  Fly  2064 SVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTD 2128
            .:.::.|:.:|...||:.:...||:|:|:..|.|:.||:::||:....|||   |..|.||::.:
Zfish  1508 RLTANHPQLNPEGLYELASVADQELYLFSPNGTHLFTRSLVTGDYLLNFTY---TPEGHLSSIAN 1569

  Fly  2129 AAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDS 2193
            ..|....|.||.......:....||...|.::...||..:|...:......|:|.||||.|..:.
Zfish  1570 REGTIAQLRRDANGVPLWLVAPGGQVYWLTISNAGMLKRISALAHDLAQLSYYGNTGLLATISNE 1634

  Fly  2194 TGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLI------QGATVI 2252
            .|.:.||.|:..|.|.:...|||.|  .||..:::.| |:|...|....:.:|      ......
Zfish  1635 NGWTSVYEYNSDGHLINVTLPTGEV--SSFHGNMEKA-VRVEATASNRENFIIITNHSADNTMYT 1696

  Fly  2253 VRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLL-----GESYPVPAKQRTEIA 2312
            :|...:.|...|..|||.......|.::.:...|    |..|.||     |..:|...:....:.
Zfish  1697 LRQAHSVSVYGVRDDGSLWVTYASGMDVSLSTEP----AVASGLLAGASAGLVHPTVGRCNITLP 1757

  Fly  2313 GDLANR-FEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRETQSVVVMVDD 2376
            |:.|:. .|||         |..:|:||   ..|...|:||.:..|||:::|.:|::...:..|.
Zfish  1758 GEPAHSLIEWR---------QRREQAKG---NYTAYERRLRAHNRNVLSIDYSQESRVGKIYDDH 1810

  Fly  2377 KQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSFDRNGRLNEIKYGD 2441
            ::..|.|.||...||:.:.|..  |..|.:.|...|.:...:.|...|...:| |||:....:.:
Zfish  1811 RKFTLRVQYDDKGRPVLWTPSK--YNQVRVSYSSEGLVTGIQRGNWTERRDYD-NGRIITRTWAN 1872

  Fly  2442 GSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSL--GFFKYQY 2504
            |....|.|.:.  |:.|.:.:.||  |..:||....|.|:|.|....|  ||||||  |:::..|
Zfish  1873 GKIWSYTFLEK--SVQLLLHSQRR--YTFEYDQTDCLLSVTLPSMVRH--SLQTSLSVGYYRNTY 1931

  Fly  2505 YSPIN-RHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQDTTSLVKS 2568
            ..|.: ...|...|..:|::|..::.....:|.:.:....||..||...:...:||.:.|..||:
Zfish  1932 TPPDSPTSSFTQDYAHDGRLLQSLYLGTGRRVIYKYSRVARLAEILYDSTLVTFTYDEATGAVKT 1996

  Fly  2569 VEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYKYAYDGNARLSGIEMAIDDKELPTTR 2633
            :.:...||.....::....::..:..|| |:..|.:||:.|:|: |.|::.::..|::..||...
Zfish  1997 IHLMHEGFVCTIRYRQTGPLVSRQIYRF-SEEGLVNARFDYSYN-NFRVTSMQAMINETPLPIDL 2059

  Fly  2634 YKYSQNLGQLE-------VVQDLK--ITRNAFNRTVIQDSAKQFFAIVDYDQHGRVKSVLMNVKN 2689
            |:|....|::|       :..||.  ||.:|...|.|            ::.:|:|..|...:..
Zfish  2060 YRYVDVSGRIEQFGKFSVINYDLNQVITTHAMKHTKI------------FNPNGQVIEVQYEILK 2112

  Fly  2690 IDVFRLELDYDLRNRIKSQKTTFGRSTAFDK--INYNADGHV--VEVLGTNNWKYLFDENGNTVG 2750
            ...:.:.|.||...|:.:.....|..:...:  ..|:|||.:  |.:.....|:|.:|.||| :.
Zfish  2113 SIAYWMTLQYDSMGRVTNCDIRIGVDSNITRYAYEYDADGQLQTVAINDRPQWRYSYDLNGN-IN 2176

  Fly  2751 VVDQGEKFN---LGYDIGDRVIKVGDVEFNNYDARGFVVKRGEQKYRYNNRGQLIHSFERERFQS 2812
            ::..|....   |.||:.||:.::|::::.. |..||:..||...:.|.:.|.|:.:::|:..|.
Zfish  2177 LLSHGNSARLTPLRYDLRDRITRLGEIQYRT-DEDGFLRLRGNLLFDYGSNGLLMGAYDRDSEQR 2240

  Fly  2813 -WYYYDDRSRLVAWHDNKGNTTQYYYANPRTPHLVTHVHFPKISRTMKLFYDDRDMLIALE-HED 2875
             ||.||...|.||...:.|...|::||:...|..|||::....:....|:||.:..|||:| ...
Zfish  2241 VWYRYDGLGRRVASRSSDGAQLQFFYADLMEPTRVTHLYNHSSAEITSLYYDLQGHLIAMEMSSG 2305

  Fly  2876 QRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQ 2940
            :.:|:|.|..|:|||.|...|.:|||::.||:|.:.:|:.|.|.:...|.|||.||.|:||:..:
Zfish  2306 EEFYIACDNAGTPLAVFSSRGHVVKEVRYTPYGDVYRDSNPTFSLIFGFQGGLYDPFTRLVHLGR 2370

  Fly  2941 RQYDPHVGQWMTP---LWETLATEMSHPTDVFIYRYHNNDPINPNKP-QNYMIDLDSWLQLFGYD 3001
            |.||...|:|.||   ||..|:.   :|....:|.:.||.|:...:. ..:..|:.|||||||:.
Zfish  2371 RDYDVVAGRWTTPNHELWAELSV---NPKPFNLYAFKNNYPLGHLQDITKFTTDISSWLQLFGFQ 2432

  Fly  3002 LNNMQSSRYTKLAQYTPQ------ASIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLK 3060
            |:|:.........:.|.|      ..|::.|.... .::.|::|.::|..:.|...|.:|     
Zfish  2433 LHNVVPGFPKPKVENTEQTYEMMATQIRTQTWDTS-KIVLGIQCDLQKNLKNFISLDRLP----- 2491

  Fly  3061 MEPK------MRNLLPRVSYRRGVFGEGVLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFL- 3118
            |.|.      .:...|..|....:||:||..:...|.....:: |..|.....|::|.|::.:| 
Zfish  2492 MTPANGKIGGRQGRRPIFSALSSIFGKGVKFAIRDGVVATEII-GVASEDSRRVAAVLNSAIYLR 2555

  Fly  3119 DLHFSIHDQDVFYFVKDNVLKLRDDNEELRRLGG-----------MFNISTHEISDHGGSAAKEL 3172
            .|||::..:|..||.|...|:     .:|...||           ..|:|..:||...|.   |:
Zfish  2556 GLHFTVEGRDTHYFTKAGPLE-----ADLGVAGGGAGGGVRVLENGVNVSVSQISAMVGG---EM 2612

  Fly  3173 RLHGPDAVV-------IIKYGVDPEQERHRILKHAHKRAVERAWELEKQLVAAGFQGRGDWTEEE 3230
            |... |.|:       .|:||..||:||.|:|..|..|||:.||..|::.|..|..|...||::|
Zfish  2613 RRFA-DIVLQQGALSFNIRYGASPEEERTRVLDAARIRAVQGAWLREQKRVLEGDGGSLAWTDKE 2676

  Fly  3231 KEELVQHGDVDGWNGIDIHSIHKYPQLADDPGNVAFQRDAKRKRR 3275
            |:||:..|.|.|::|.....:.::|:|||.|.|:...|..:..||
Zfish  2677 KDELIAEGHVSGYDGFYALPVEQHPELADSPFNIHLIRHVETGRR 2721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 63/129 (49%)
CRD2 1106..1151 CDD:276900 20/45 (44%)
EGF_2 1139..1162 CDD:285248 10/23 (43%)
Keratin_B2 1162..1330 CDD:279797 77/179 (43%)
EGF_2 1167..1194 CDD:285248 13/27 (48%)
DUF3844 1171..>1235 CDD:289707 31/65 (48%)
EGF_2 <1272..1294 CDD:285248 12/22 (55%)
NHL 1750..2065 CDD:302697 119/324 (37%)
NHL repeat 1784..1830 CDD:271320 14/46 (30%)
NHL repeat 1854..1888 CDD:271320 15/34 (44%)
NHL repeat 1911..1950 CDD:271320 19/39 (49%)
NHL repeat 1972..2005 CDD:271320 12/33 (36%)
NHL repeat 2039..2065 CDD:271320 11/26 (42%)
RHS_repeat 2183..2218 CDD:283287 14/35 (40%)
RhsA 2347..3020 CDD:225750 202/704 (29%)
YD_repeat_2x 2795..2836 CDD:273728 14/42 (33%)
Rhs_assc_core 2905..2980 CDD:274730 30/78 (38%)
Tox-GHH 3193..3268 CDD:292269 29/75 (39%)
tenm1XP_691552.5 Ten_N <92..294 CDD:284015 38/220 (17%)
EGF_2 511..537 CDD:285248 14/26 (54%)
TNFRSF 582..725 CDD:304602 64/147 (44%)
CRD2 618..658 CDD:276900 19/44 (43%)
CarboxypepD_reg 870..943 CDD:290350 36/73 (49%)
NHL 1149..1509 CDD:302697 137/361 (38%)
NHL repeat 1178..1213 CDD:271320 19/35 (54%)
NHL repeat 1229..1272 CDD:271320 13/43 (30%)
NHL repeat 1296..1334 CDD:271320 15/38 (39%)
NHL repeat 1352..1391 CDD:271320 19/39 (49%)
NHL repeat 1415..1448 CDD:271320 12/33 (36%)
NHL repeat 1483..1509 CDD:271320 11/26 (42%)
RhsA 1586..2425 CDD:225750 246/886 (28%)
Rhs_assc_core 2334..2411 CDD:274730 30/80 (38%)
Tox-GHH 2639..2714 CDD:292269 29/75 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C82533330
eggNOG 1 0.900 E1_KOG4659
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000499
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128674
Panther 1 1.100 O PTHR11219
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.