DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ten-m and shf

Sequence 1:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster
Sequence 2:NP_001284963.1 Gene:shf FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster

Alignment Length:365 Identity:82/366 (22%)
Similarity:125/366 (34%) Gaps:96/366 (26%)


  Fly   957 KLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHFKEVLSGFSASTR 1021
            ::|.:::..:.:|.....||..||.|.:.         .|||...     |.|..:.   :....
  Fly   149 RVTNDLRDTTLYNFLVIPSEVNYVNFTWK---------SGRRKYF-----YDFDRLQ---TMDES 196

  Fly  1022 TARAAHLSITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLG-- 1084
            ..:|..|||.:......|..::.:.|                      .|....||.....:|  
  Fly   197 ILKAPTLSIRKSGRIPQEQKNFSIFL----------------------PCTGNSSGTASFNVGLK 239

  Fly  1085 -HCQCNPGFGGDDCSESVCPVL------CSQHGEY----TNGECICNPGWKGKECSLRHDECEVA 1138
             ..:.|....|       .|:.      |:..|.|    :|...:........||||:       
  Fly   240 IQTRHNKPLSG-------TPIRLNFKKECAHRGVYDIDASNPTSLTTLQAPDPECSLK------- 290

  Fly  1139 DCSGHGHCVSGK-CQCMRGYKGKFCEEVDCPHPNCSGHGFC-ADGTCICKKGWKGPDCATMDQDA 1201
             |..:|:|.... |:|..||.|::||...| .|.|...|.| |...|.|.:|::|..|     :.
  Fly   291 -CGKNGYCNEHHICKCNVGYTGQYCETAFC-FPQCLNGGNCTAPSVCTCPEGYQGTQC-----EG 348

  Fly  1202 LQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEG-DACACDPEWGGEYC-- 1263
            ..|...|...|.. :....|.|...:.|..|....|.:.|...|||.| :.|.|.....|::|  
  Fly   349 GICKDKCLNGGKC-IQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEI 412

  Fly  1264 ---NTRLCDVRCNEHGQCKNGTCL------CVTGWNGKHC 1294
               ...:|        :|:||||:      |..|:.|:||
  Fly   413 GRKQRSIC--------KCRNGTCVSHKHCKCHPGFYGRHC 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 36/144 (25%)
CRD2 1106..1151 CDD:276900 11/50 (22%)
EGF_2 1139..1162 CDD:285248 8/24 (33%)
Keratin_B2 1162..1330 CDD:279797 41/147 (28%)
EGF_2 1167..1194 CDD:285248 10/28 (36%)
DUF3844 1171..>1235 CDD:289707 16/65 (25%)
EGF_2 <1272..1294 CDD:285248 9/28 (32%)
NHL 1750..2065 CDD:302697
NHL repeat 1784..1830 CDD:271320
NHL repeat 1854..1888 CDD:271320
NHL repeat 1911..1950 CDD:271320
NHL repeat 1972..2005 CDD:271320
NHL repeat 2039..2065 CDD:271320
RHS_repeat 2183..2218 CDD:283287
RhsA 2347..3020 CDD:225750
YD_repeat_2x 2795..2836 CDD:273728
Rhs_assc_core 2905..2980 CDD:274730
Tox-GHH 3193..3268 CDD:292269
shfNP_001284963.1 WIF 137..258 CDD:280237 25/155 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1225
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.