DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ten-m and Tenm3

Sequence 1:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster
Sequence 2:XP_008769466.1 Gene:Tenm3 RGDID:1306641 Length:2721 Species:Rattus norvegicus

Alignment Length:2987 Identity:916/2988 (31%)
Similarity:1443/2988 (48%) Gaps:494/2988 (17%)


  Fly   507 SAAKTLVNKRRKYDHGTVEAEHIKHEEEEEEDEQKLERHEAIGMATELTTESETSTLPAVIDDDN 571
            |..|:...|.|:|.:.:.:      .||.....||              :.|.:.||.|.   |:
  Rat    11 SLTKSRREKERRYTNSSAD------NEECRVPTQK--------------SYSSSETLKAF---DH 52

  Fly   572 QSDNSSSGPTPETTVRSDTDDIVEINTPPSQ-------------TAQRTFAAVSHQPAIEH-DFQ 622
            .|.....|...:..|..:.|:.      |.|             :|.|...|...:..:.| .:.
  Rat    53 DSSRLLYGNRVKDLVHREADEY------PRQGQNFTLRQLGVCESATRRGVAFCAEMGLPHRGYS 111

  Fly   623 IK-GTDAGGLQTEKPATDDINNERDLADNYEVDSKEPTSPGTPPQGKVSQQTGKASLQSLQSESD 686
            |. |:||           |..||..::..:.:..          .|: ..::|::|..|.:|.|.
  Rat   112 ISAGSDA-----------DTENEAVMSPEHAMRL----------WGR-GVKSGRSSCLSSRSNSA 154

  Fly   687 LMMNDASHYEDIDIVKLDGLTISHEEEIYKTADKENMAPKNQPSQHIDRSQNEVLKGHQQGDEKQ 751
            |.:.|..|                    ...:|.|:..|.|                 .||   |
  Rat   155 LTLTDTEH--------------------ENRSDSESEQPAN-----------------NQG---Q 179

  Fly   752 PQLEPLKPYVSERVDLPGKRIFLNLTIATDEGSDSVYTLHVEVPTGGGPHFIKEVLTHEKPTAQA 816
            |.|:||.|...:.   |...             .||.:|:            :..||:.:..:  
  Rat   180 PTLQPLPPSHKQH---PAHH-------------PSVTSLN------------RNSLTNRRNQS-- 214

  Fly   817 DSCVPEPPPRMPDCPCSCLPPPAPIYLDDT------VDIDS------------------------ 851
                |.||..:   |......|..:.|.|:      |.::|                        
  Rat   215 ----PAPPAAL---PAELQTTPESVQLQDSWVLGSNVPLESRHFLFKTGTGTTPLFSTATPGYTM 272

  Fly   852 ------APPAKTVTTSTISAPINPF---------------------------------------- 870
                  :||.:.:..:|:|.....|                                        
  Rat   273 ASGSVYSPPTRPLPRNTLSRSAFKFKKSSRYCSWRCTALCAVGVSVLLAILLSYFIAMHLFGLNW 337

  Fly   871 ---HSEEEDDEDGVRDEEQTPSSSTATNLPSTEIDNHIAAFTEPAVGAGGVPFACPDVMPVLILE 932
               .:|.:..|:|..:.:..|:.:  .:|||.: :..:..||.                      
  Rat   338 HLQQTENDTFENGKVNSDTVPTHT--VSLPSGD-NGKLGGFTH---------------------- 377

  Fly   933 GARTFPARSFPPDGTTF--GQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGVY 995
                        :..|.  |::.:|::..:|:.|..:|..|.:..:|.::||:.::.:.|.||||
  Rat   378 ------------ENNTIDSGELDIGRRAIQEVPPGIFWRSQLFIDQPQFLKFNISLQKDALIGVY 430

  Fly   996 GRRNALPTHTQYHFKEVLSG----------FSASTRTARAAHLSITREV--TRYMEPGHWFVSLY 1048
            ||:...|:||||.|.|:|.|          ...|.|..|.|......|.  .:|::.|.|.::.|
  Rat   431 GRKGLPPSHTQYDFVELLDGSRLIAREQRNLVDSERAGRQARSVSLHEAGFIQYLDSGIWHLAFY 495

  Fly  1049 NDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYT 1113
            ||..:.::::|...|.|.:.: ||..|.|||:|:.|.|.|.|||.|.|||.:.||||||.:|:|:
  Rat   496 NDGKNPEQVSFNTIVIESVVE-CPRNCHGNGECVSGTCHCFPGFLGPDCSRAACPVLCSGNGQYS 559

  Fly  1114 NGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFC 1178
            .|.|:|..||||.||.:...:|....|.|.|.|:.|.|.|..||||:.|||.||..|.||.||.|
  Rat   560 KGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGENCEEADCLDPGCSNHGVC 624

  Fly  1179 ADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQ 1243
            ..|.|.|..||.|.:|..:   ...|...||||||:..::.:|||:..|:|.|||.|:|.:|||.
  Rat   625 IHGECHCNPGWGGGNCEIL---KTMCPDQCSGHGTYLQESGSCTCDPNWTGPDCSNEICSVDCGS 686

  Fly  1244 HGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTI------------ 1296
            ||.|.|..|.|:..|.|..||.|.|..||.|||.||:|.|.|..||||:||||            
  Rat   687 HGVCMGGTCRCEEGWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGEHCTIAHYLDKIVKADK 751

  Fly  1297 ----EGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPEC 1357
                ||||..|..:|:|.:...| |.|.|..||.|..|.:|:|..|.|||||:.||||||.||:|
  Rat   752 IGYKEGCPGLCNSNGRCTLDQNG-WHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLVDCMDPDC 815

  Fly  1358 CASHVCKTSQLCVSAPKPIDVLLRK-QPPAITA--SFFERMKFLIDESSLQNYAKLETFNESIFW 1419
            |....|:....|...|.|.||:.:. |.|:..|  ||::|:.|||...|.........||:|:  
  Rat   816 CLQSSCQNQPYCRGLPDPQDVISQSLQTPSQQAAKSFYDRISFLIGSDSTHVLPGESPFNKSL-- 878

  Fly  1420 NYFNASRSAVIRGRVVTSLGMGLVGVRVSTTTLLE-GFTLTRDDGWFDLMVNGGGAVTLQFGRAP 1483
                   ::||||:|:|:.|..|:||.||.....| |:|:||.||.|||:.|||.::||.|.|:|
  Rat   879 -------ASVIRGQVLTADGTPLIGVNVSFLHYSEYGYTITRQDGMFDLVANGGASLTLVFERSP 936

  Fly  1484 FRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKPVVLASWKHGFQGACPD 1548
            |..|...|.:|||...::|.:||. .||..:.     :|....:....||:::|....|..:.|:
  Rat   937 FLTQHHTVWIPWNVFYVMDTLVMK-KEENDIP-----SCDLSGFVRPSPVIVSSPLSTFFRSSPE 995

  Fly  1549 RSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILF 1613
            .|.|:.|:||:.|...||||.|.|.|.|||||||.|.:|:.:|...||.:|..:||.:.:.|.||
  Rat   996 DSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKVTMTQATIPFNLMKVHLMVAVVGRLF 1060

  Fly  1614 ERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDI-VWDIQTTKLSGHDMSISE 1677
            ::.|.|.|.:.:|:.|::.:.|.|:|||::.|||.|||:|..|.|: :|:.:|..|.|:::..|.
  Rat  1061 QKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASN 1125

  Fly  1678 VGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGDGHQRPLECPDCDGQATKQRLLAP 1742
            :|||.||.||..:...|||.||:|.|.::..:|.::.:.||:|.:|.:.||.|:|||...:||||
  Rat  1126 MGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAP 1190

  Fly  1743 VALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKL------NATRVSYRYHMALSPLDGTLYVSDP 1801
            ||||...||||:||||||:|||...|::.:|::|      :::..::||::|..|:.|.|||||.
  Rat  1191 VALACGIDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDFRHSSNPAHRYYLATDPVTGDLYVSDT 1255

  Fly  1802 ESHQIIRVRDTNDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILY 1866
            .:.:|.|.:..........|.|.|.|:||:|||.|||.||||..|.:|.|..|||:||..:.::|
  Rat  1256 NTRRIYRPKSLTGAKDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAIDKNGLIY 1320

  Fly  1867 FADGTNIRMVDRDGIVSTLIGNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDD 1931
            |.|||.||.||::||:|||:|::...|. :|:.|:.::.:.::.|.|||:||::||||:::::|:
  Rat  1321 FVDGTMIRKVDQNGIISTLLGSNDLTSA-RPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDN 1384

  Fly  1932 HMILRMTPDGRVRVISGRPLHCATASTAYDTDL-ATHATLVMPQSIAFGPLGELYVAESDSQRIN 1995
            :::|::|.:.:||:.:|||:||......|.... |...||....:||....|.||:.|:|.::||
  Rat  1385 NVVLQITENRQVRIAAGRPMHCQVPGVEYPVGKHAVQTTLESATAIAVSYSGVLYITETDEKKIN 1449

  Fly  1996 RVRVIGTDGRIAPFAGAESKCNCL-ERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQAN 2059
            |:|.:.|||.|:..||..|:|:|. :..|||::.....|..||.:..::||.:||..::|||..|
  Rat  1450 RIRQVTTDGEISLVAGIPSECDCKNDANCDCYQTGDGYAKDAKLSAPSSLAASPDGTLYIADLGN 1514

  Fly  2060 YRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLS 2124
            .|||:|..:.|..:....||:.:|..||:|||:..|.|..|.:::||:..|.|:|   :::..::
  Rat  1515 IRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSY---SNDNDVT 1576

  Fly  2125 TVTDAAGNKVFLLRD---YTSQVNSIEN--------TKGQKCRLRMTRMKMLHELSTPDNYNVTY 2178
            .|||:.||.:.:.||   ...:|.|.:|        |.|  |...||...:  ||       |.:
  Rat  1577 AVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNG--CLKSMTAQGL--EL-------VLF 1630

  Fly  2179 EYHGPTGLLRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKE-- 2241
            .|||.:|||.||.|.||.:..::||..||||:...|||.|..|..|:. |...|.:..::::|  
  Rat  1631 TYHGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGDMD-KAITVDIESSSREEDV 1694

  Fly  2242 -----MSLLIQGATVI---VRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLG 2298
                 :|.:....|::   :||.     ..:..|||.......|.:...:..|:.       |.|
  Rat  1695 SITSNLSSIDSFYTMVQDQLRNS-----YQIGYDGSLRIFYASGLDSHYQTEPHV-------LAG 1747

  Fly  2299 ESYPVPAKQRTEIAGDLA-NRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLE 2362
            .:.|..||:...:.|:.. |..|||:  |::|     .|.|     |...||||||||.|:|:::
  Rat  1748 TANPTVAKRNMTLPGENGQNLVEWRF--RKEQ-----AQGK-----VNVFGRKLRVNGRNLLSVD 1800

  Fly  2363 YDRETQSVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYS 2427
            :||.|::..:..|.::.||.:.||.:..|..:.|.|...| |::.|...|::.|.:.|...|...
  Rat  1801 FDRTTKTEKIYDDHRKFLLRIAYDTSGHPTLWLPSSKLMA-VNVTYSSTGQIASIQRGTTSEKVD 1864

  Fly  2428 FDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFS 2492
            :|..||:....:.||.|..|.:.:.  |:.|.:.:.|:  |:.:||....|.::|.|....|...
  Rat  1865 YDSQGRIVSRVFADGKTWSYTYLEK--SMVLLLHSQRQ--YIFEYDMWDRLSAITMPSVARHTMQ 1925

  Fly  2493 LQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHY 2557
            ...|:|:::..|..|.:.......||:||.:|.......|.:|.|.:....||..||...:...:
  Rat  1926 TIRSIGYYRNIYNPPESNASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSF 1990

  Fly  2558 TYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYKYAYDGNARLSGIEM 2622
            ||.:|..::|:|.:|..||.....::....::..:..|| |::.:.:||:.|:||.:.|::.::.
  Rat  1991 TYDETAGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRF-SEDGMVNARFDYSYDNSFRVTSMQG 2054

  Fly  2623 AIDDKELPTTRYKYSQNLGQLE-------VVQDLKITRNAFNRTVIQDSAKQFFAIVDYDQHGRV 2680
            .|::..||...|::....|::|       :..|:    |....|.:....|.|      |.|||:
  Rat  2055 VINETPLPIDLYQFDDISGKVEQFGKFGVIYYDI----NQIISTAVMTYTKHF------DAHGRI 2109

  Fly  2681 KSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFG--RSTAFDKINYNADGHVVEVLGTNN--WKYL 2741
            |.:...:....::.:.:.||...|:..::...|  .:|......|:.||.:..|.....  |:|.
  Rat  2110 KEIQYEIFRSLMYWITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKIMWRYN 2174

  Fly  2742 FDENGN--TVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVKRGEQKYRYNNRGQLIHS 2804
            :|.|||  .:..........|.||:.||:.::|||:: ..|..||:.:||.:.:.|:::|.|...
  Rat  2175 YDLNGNLHLLNPSSSARLTPLRYDLRDRITRLGDVQY-RLDEDGFLRQRGTEIFEYSSKGLLTRV 2238

  Fly  2805 FERERFQSW---YYYDDRSRLVAWHDNKGNTTQYYYANPRTPHLVTHVHFPKISRTMKLFYDDRD 2866
            :.:.  ..|   |.||...|.|:...:.|...|::||:...|..:|||:....|....|:||.:.
  Rat  2239 YSKG--SGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTYPTRITHVYNHSSSEITSLYYDLQG 2301

  Fly  2867 MLIALE-HEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLID 2930
            .|.|:| .....:|:|:|..|:|||.|..||.::|:::.|.:|.|..|:..:|.:.|.|||||.|
  Rat  2302 HLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNIDFQLVIGFHGGLYD 2366

  Fly  2931 PHTKLVYTEQRQYDPHVGQWMTP---LWETLATEMSHPTDVFIYRYHNNDPINP-NKPQNYMIDL 2991
            |.|||::..:|.||...|:|.||   :|:.:..:   |....:|.:.||:|.:. :..::|:.|:
  Rat  2367 PLTKLIHFGERDYDILAGRWTTPDIEIWKRIGKD---PAPFNLYMFRNNNPASKIHDVKDYITDV 2428

  Fly  2992 DSWLQLFGYDLNN-MQSSRYTKLAQYTPQASIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVP 3055
            :|||..||:.|:| :......|.....|...:..:....|...|.|::..|.:.::.|....   
  Rat  2429 NSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWEDVPPIFGVQQQVARQAKAFLSLG--- 2490

  Fly  3056 KPLLKMEPKMRNLLPRVSYR--------------RGVFGEGVLLSRIGGRALVSVVDGSNSVVQD 3106
                    ||..:  :||.|              :.:.|:||:|:...||...:|::.:|   :|
  Rat  2491 --------KMAEV--QVSRRKAGGEQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLNIAN---ED 2542

  Fly  3107 V--VSSVFNNSYFLD-LHFSIHDQDVFYFVKDNVLKLRDDNEELRRLGG---------------- 3152
            .  |::|.||:::|: |||:|..:|..||:|....:  .|...||...|                
  Rat  2543 CIKVAAVLNNAFYLENLHFTIEGKDTHYFIKTTTPE--SDLGTLRLTSGRKALENGINVTVSQST 2605

  Fly  3153 -MFNISTHEISD---HGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHAHKRAVERAWELEK 3213
             :.|..|...:|   ..|:    |.||       ::||:..::|:.|||:.|.:||:.|||..|:
  Rat  2606 TVVNGRTRRFADVEMQFGA----LALH-------VRYGMTLDEEKARILEQARQRALARAWAREQ 2659

  Fly  3214 QLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADDPGNVAFQRDAKRKRR 3275
            |.|..|.:|...|||.||.:|:..|.|.|::|..:.|:.:||:|||...|:.|.|.::..:|
  Rat  2660 QRVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVEQYPELADSANNIQFLRQSEIGKR 2721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 64/129 (50%)
CRD2 1106..1151 CDD:276900 19/45 (42%)
EGF_2 1139..1162 CDD:285248 11/23 (48%)
Keratin_B2 1162..1330 CDD:279797 82/184 (45%)
EGF_2 1167..1194 CDD:285248 13/27 (48%)
DUF3844 1171..>1235 CDD:289707 27/64 (42%)
EGF_2 <1272..1294 CDD:285248 14/22 (64%)
NHL 1750..2065 CDD:302697 131/323 (41%)
NHL repeat 1784..1830 CDD:271320 17/46 (37%)
NHL repeat 1854..1888 CDD:271320 20/34 (59%)
NHL repeat 1911..1950 CDD:271320 17/39 (44%)
NHL repeat 1972..2005 CDD:271320 14/33 (42%)
NHL repeat 2039..2065 CDD:271320 11/26 (42%)
RHS_repeat 2183..2218 CDD:283287 17/35 (49%)
RhsA 2347..3020 CDD:225750 197/695 (28%)
YD_repeat_2x 2795..2836 CDD:273728 11/44 (25%)
Rhs_assc_core 2905..2980 CDD:274730 29/78 (37%)
Tox-GHH 3193..3268 CDD:292269 32/75 (43%)
Tenm3XP_008769466.1 Ten_N 11..307 CDD:284015 72/424 (17%)
EGF_2 <521..543 CDD:285248 13/22 (59%)
Keratin_B2 578..730 CDD:279797 72/155 (46%)
EGF_2 582..608 CDD:285248 11/26 (42%)
EGF_CA 612..641 CDD:238011 15/29 (52%)
EGF_2 648..675 CDD:285248 12/27 (44%)
DSL <665..706 CDD:302925 20/41 (49%)
DSL <696..737 CDD:302925 22/41 (54%)
EGF_CA 759..788 CDD:238011 11/30 (37%)
NHL 1161..1520 CDD:302697 149/360 (41%)
NHL repeat 1190..1229 CDD:271320 21/39 (54%)
NHL repeat 1241..1284 CDD:271320 15/43 (35%)
NHL repeat 1308..1342 CDD:271320 20/34 (59%)
NHL repeat 1364..1403 CDD:271320 17/39 (44%)
NHL repeat 1426..1459 CDD:271320 14/33 (42%)
NHL 1489..>1615 CDD:302697 42/129 (33%)
NHL repeat 1494..1520 CDD:271320 11/26 (42%)
NHL repeat 1496..1523 CDD:271320 12/27 (44%)
NHL repeat 1570..1613 CDD:271320 10/43 (23%)
YD_repeat_2x 1845..1885 CDD:273728 12/40 (30%)
RhsA <1925..2436 CDD:225750 147/528 (28%)
Rhs_assc_core 2340..2414 CDD:274730 28/77 (36%)
Tox-GHH 2639..2714 CDD:292269 32/75 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C82524386
eggNOG 1 0.900 E1_KOG4659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000499
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128674
Panther 1 1.100 O PTHR11219
Phylome 1 0.910 0.889 Consistency score
TreeFam 1 0.960
87.710

Return to query results.
Submit another query.