DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ten-m and ten-1

Sequence 1:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster
Sequence 2:NP_001254940.1 Gene:ten-1 WormBaseID:WBGene00006498 Length:2837 Species:Caenorhabditis elegans

Alignment Length:3183 Identity:800/3184 (25%)
Similarity:1311/3184 (41%) Gaps:757/3184 (24%)


  Fly   466 TPDTSYDYVY-------EDEV--EPETTPSLIRRTKTGQQFGKSLNSNLRSAAKTLVNKRRKYDH 521
            |||.....|:       :|:|  .|:||...|..|....: .|.||....|:..|          
 Worm    11 TPDLVVRKVFRIKTLRRDDDVTPRPKTTEPPIELTVCSSE-TKKLNEVTTSSVDT---------- 64

  Fly   522 GTVEAEHIKHEEEEEEDEQKLERHEAIGMATELTT---------ESETSTLPAVIDDDNQSDNSS 577
                         ...|.....|.||.|..:::..         |:......|.:.|::::..|:
 Worm    65 -------------SSTDTCTTSRMEAGGTPSKVPVLAVGTYHRKEAAPILAAAAMLDNSKATTST 116

  Fly   578 SGPTPETTVRSDTDDIVEINTP-PSQTAQRTFAAVSHQPAIEHDFQIKGTDAGGLQTEKPATDDI 641
            :.|:..:|:..|.........| ||:..|   ..||.|..:   ||.:.|:|.|....:|..   
 Worm   117 AQPSIMSTLTKDKHKEPAPPLPHPSECGQ---PCVSGQSQM---FQHRTTNAQGPPPNRPMP--- 172

  Fly   642 NNERDLADNYEVDSKEPTSPGTPPQGKVSQQTGKASLQSLQSESDLMMNDASHYEDIDIVKLDGL 706
                                 .||.|                   :.|..:||..|        .
 Worm   173 ---------------------RPPAG-------------------MPMMTSSHEHD--------Y 189

  Fly   707 TISHEEEIYKTADKENMA----------------PKNQP-----SQHIDRSQNEVLKGHQQGDEK 750
            |..:|       |.|.||                |..||     |..:..||....:.|||    
 Worm   190 TNDYE-------DPEEMARSRGEGFSNHLLIKTTPPPQPHPNFNSYEMSMSQQRRSQQHQQ---- 243

  Fly   751 QPQLEPLKPYVSERVDLPGKRIFLNLTIATDEG-----SDSVYTLHVEVPTGGGPHFIKEVLTHE 810
                 |:.|.:|   |..|..:.       |.|     :|..|    .:|:|.           .
 Worm   244 -----PMAPPLS---DCWGSGVH-------DSGVLHKNADGAY----YIPSGS-----------L 278

  Fly   811 KPTAQADSCVPEPPPRMPDCPCSCLPPPAPIYLDDTVDIDSAPPA---------KTVTTSTISAP 866
            :.|:...|  |....|..|.|.:....|.|.|.|.:..:...|.|         :.|.|.....|
 Worm   279 RTTSSTLS--PASGQRYLDQPHTSGGAPNPTYSDASTTLLKYPLAAGTNQNRRRQQVGTMNNGDP 341

  Fly   867 I--NPF---HSEEEDDEDGVRDEEQTPSSSTATNLPST---------------------EIDNHI 905
            :  .|.   ..:::.|:|          |.|.:..||.                     ...|::
 Worm   342 VAGGPMALSKKKKKFDDD----------SDTCSRWPSKWNILLAAALLVALFVICILLFRAPNYV 396

  Fly   906 AAFTEPAVGAGGVPFACPDVMPVLILEGARTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNM 970
              :|:||..:.....|      .......:....|:.||      .|:||:::..|..|.|....
 Worm   397 --YTQPAPSSDATSSA------AAAASRYQDLGLRALPP------AISLGERVDVEFFPKSMATT 447

  Fly   971 QFYQSEPAYVKFDYTIPRGA------SIGVYG----------------RRNALPTHTQYHFKEVL 1013
            :...::|:.::|:.|:..||      |.||:.                |.:..|||       ::
 Worm   448 ELTVTKPSRIRFNATVGSGAQLVLLMSAGVHPSLSLHDALFPIRADRIRDSKSPTH-------IV 505

  Fly  1014 SGFSASTRTARAAHLSITREV----------TRYMEPGHWFVSLYNDDGDVQELTFYAAVAEDMT 1068
            ..|.:.:|.:..|..|..|.:          .:::..|..:::..|:...|:.::|   |||::.
 Worm   506 EEFGSRSRRSLGASSSRHRNIEILSPRSATFEQFVLEGRHYLTFINERSRVEPISF---VAEELQ 567

  Fly  1069 QN------------------------CPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQH 1109
            :.                        |.:.|:..|:|:.|.|.|.|||.|..|.|:||||:||.:
 Worm   568 RPTTPPKTSSSGTSGAKEHPLASVLVCESNCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGN 632

  Fly  1110 GEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHC-VSGKCQCMRGYKGKFCEEVDCPHPNCS 1173
            |.::.|.|:|..|:|||||.:||:.||||||:|.|.| ..|:|:|..|:.|:.||...|||.:|.
 Worm   633 GVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCH 697

  Fly  1174 GHGFCADGTCICKKGWKGPDCATMDQDALQCLPD------------------------------- 1207
            ..|.|.:|||.|..||:|.||:.. .||:..:|.                               
 Worm   698 DRGVCVNGTCYCMDGWRGNDCSVF-ADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKK 761

  Fly  1208 -----------------------CSGHGTFDLDTQTCTCEAKWSGDDCSKELCDL---DCGQHGR 1246
                                   ||.||  .|....|.||:.|...|||::.|..   ||...|.
 Worm   762 KESRELQKPIIATVQVPTESSHPCSAHG--QLIDDICQCESGWDSVDCSQQACQCVNGDCLDDGS 824

  Fly  1247 CEGDACACDPEWGGEYCNTRLCDVRCNEHGQC-KNGTCLCVTGWNGKHCTIEGCPNSCAGHGQC- 1309
            |:     |...|.|..|..:.|.:.|.:.|:| .:|:|.|.:||||::|.|:||||.|:|.|:| 
 Worm   825 CQ-----CWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECG 884

  Fly  1310 --RVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVSA 1372
              |.|.|  |.|||..|..|.||.:::|::|.|..|||.|||:||:|||||:|..|.:..:|.:|
 Worm   885 MDRRSSE--WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTA 947

  Fly  1373 PKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYAKLETFNESIFWNYFNASRSAVIRGRVV-- 1435
            ..||:||:| .||...|:|.:|:.|||.|.|:|:|.....|||::.         :||||||:  
 Worm   948 ASPIEVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLI---------SVIRGRVMWG 1002

  Fly  1436 -------------TSLGMGLVGVRVSTTT-LLEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRP 1486
                         ....:.|||||||... .|.||||||:||:|||.|||..:|||||.|..|:.
 Worm  1003 GSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFLRTQFQS 1067

  Fly  1487 QSRIVQVPWNEVVIIDLVVM-----------SMSEEKGLAVTTTHTCFAHDYDLMKPVVLASWKH 1540
            ..:.|.|...:::.||.:|:           ||:..:.....|...       :...|::::|::
 Worm  1068 VKKSVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRR-------IPDVVLISNWQY 1125

  Fly  1541 GFQG----ACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHL 1601
            ...|    ...|.|.|:.:|:.|.|||.|.||.:.|||.|:|:....||:.:.|..|.:...|..
 Worm  1126 TSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLYDRVDKELRK 1190

  Fly  1602 IHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDC---TDIVWDI 1663
            :|:.|.|.|..|:|:......:.:.:||:::|.|||...|:....|:|||:|..|   ::.||..
 Worm  1191 VHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYEYQGCDRTSERVWQT 1255

  Fly  1664 QTTKLSGHDMSISEVGG--WNLDIHHRYNFHEGILQKGDGS-NIYLRNKPRIILTTMGDGHQRPL 1725
            :.:::.|  .:..::.|  |.|||||..:....:::.|:|. .:...::||:......||.:|.:
 Worm  1256 RRSQMMG--ATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITESEPRVSTFAGLDGVKRDV 1318

  Fly  1726 ECPDCDGQATKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALS 1790
            ||..|:|:.....|..|..:..|.||||.:||.|.|||:..||.:.|::.|.....|:.|::|:|
 Worm  1319 ECLKCEGKVDSISLFRPTTVVYAQDGSLIIGDHNMIRRVSQDGQVSTILTLGLADTSHSYYIAVS 1383

  Fly  1791 PLDGTLYVSDPESHQIIRV-----RDTNDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAK 1850
            |:|||:.:|.|...|:.|:     :|:.:      |::.:.|.|..|....:: |||||||::|:
 Worm  1384 PVDGTIAISLPLHKQVWRISSLEPQDSRN------NYDVLAGDGTVCASAVDS-CGDGALAQNAQ 1441

  Fly  1851 LAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLIGNHMHKSHWKPI-PCEGTLKLEEMHLRWP 1914
            |.:||||:......||.||...||::|..|.:.: ||......|  || .|....||.::.:.||
 Worm  1442 LIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-IGETTPDQH--PIRTCAQITKLVDLQMEWP 1503

  Fly  1915 TELAVSPMDNTLHIIDDHMILRM-TPDGRVRVISGRPLHC----ATAS-TAYDTDLATHATLVMP 1973
            |.|.:.|:..::.::|.:::..: .....|.:..|.|..|    ||:| :|...|...| .:...
 Worm  1504 TSLTIDPITGSVLVLDTNVVYEIDVVHDVVTIALGSPTTCDLANATSSASAKSLDHRRH-LIQNA 1567

  Fly  1974 QSIAFGPLGELYVAESDSQRINRVRVIGTD-GRIAPFAGAESKCNCLERGCDCFEA---EHYLAT 2034
            :.|..|..|.:||.|||.:|:|:||.:.:| ...:...|.:|.|:|....|.|.:|   ....|:
 Worm  1568 RDITVGTDGAIYVVESDGRRLNQVRKLSSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAAS 1632

  Fly  2035 SAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIPE-ASPSREYEIYAPDMQEIYIFNRFGQHV 2098
            .|..::..|:.|:|...|.|||..|.:|:.|.:.:.: ...||.||:...:.||.|.|||.|||.
 Worm  1633 QAHLSSPYAVCVSPSGDVIIADSGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHS 1697

  Fly  2099 STRNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMK 2163
            ||.:::||.|.:.|:|.|::....:|.:..|:|..:.:|:...| :..:|.|.||:..|.|:...
 Worm  1698 STVSLITGRTFFNFSYQVDSPISMISEIRAASGVVLRVLKRNDS-LFDLETTLGQRTTLTMSAYD 1761

  Fly  2164 -MLHELSTPD---NYNVTYEYHGPTGLLRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFD 2224
             .|.::|..|   :.:.|..:: ..|||.:::| ...:..:.|||:          ||.|.|..|
 Worm  1762 GTLEQVSKRDSATSRDATKLFY-KKGLLTSRID-VATAVGFEYDEY----------GRAIGLKRD 1814

  Fly  2225 ----------LSVKGAQVKVSENAQKEMSLLIQGATVIVRNGAAESRTTVDMDGSTT---SITPW 2276
                      :|:.....:|..|.|:...:.:....:.|.:          .:|:||   |:...
 Worm  1815 REYWRLGEETISMGSVNTEVLLNGQRFQQVRLGEGNLAVHS----------TNGATTRLISLRNE 1869

  Fly  2277 GHNLQMEVAPYTILAEQSPL---LGESYPVPAKQRTEIAG-------DLANRFEWRYFVRRQQPL 2331
            |::|...:...|:..:.|.:   .||  |:.:::||::..       :|..|::||:..||    
 Worm  1870 GYSLASPLGTSTLYDKSSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARR---- 1928

  Fly  2332 QAGKQSKGPPRPVTEVGRK--LRVNGDNVLTLEYD----RETQSVVVMVDDKQELLNVTYDRTS- 2389
              |..|.|      .:||:  ..:||.|:.::|||    ::|..:....||.|.||.:.|..:. 
 Worm  1929 --GDDSDG------SLGRRKVAEINGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGR 1985

  Fly  2390 -RPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSFDRNGRLNEIKYGDGSTMVYAFKDMF 2453
             |.|| .|:....|::::.:|..||.....||..:...::|.:.||.|... ||:          
 Worm  1986 IRRIS-APEDSQMAEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGA---------- 2038

  Fly  2454 GSLPLKVT---TPRRSDYL--------LQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKY--QYY 2505
             .:|:|::   ..||.:.:        :|||:...::.:.:......:|| ..:||..::  :..
 Worm  2039 -RVPIKMSYAGASRRPNEIQHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRR 2101

  Fly  2506 SPINRHPFEILYNDEGQILAKIHPHQSGKVAFVH-------DTAGRLETIL-------------- 2549
            :.:|..|..:..:.||::|....|.::      |       ...||...||              
 Worm  2102 TSLNSKPSLVRLSREGKVLESTTPDEN------HYWLERKDPITGRTTEILNDEETTVVTCWSPE 2160

  Fly  2550 -AGLSSTHYTYQDTTSLV------KSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARY 2607
             |.:.|.....|:.|::.      |||.:..|                     ..|:.|:.|: :
 Worm  2161 GAPMCSRSRNLQENTTMQGHLVARKSVTIMTP---------------------TSSEPSITSS-F 2203

  Fly  2608 KYAYDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQFFAIV 2672
            .|.||...|::.|:..|:...|.:.:..|.:..|.:..:...|..|:|.....            
 Worm  2204 TYEYDDMLRVTTIQPVIEQSVLESIQLSYDERRGHVAAINGFKWARDASTSRC------------ 2256

  Fly  2673 DYDQHGRVKSVLMNVKNIDVFRLELDYDL-----RNRIKSQKTTFGRSTAF-----DKINYNADG 2727
              ..||                  |.|:.     ..::..:|..||.:.|.     ||....::.
 Worm  2257 --QGHG------------------LMYETSKANDHRQVVERKLIFGDARASIKIIRDKAGRASES 2301

  Fly  2728 HV-VEVLGT-NNWKY--LFDENGNTVGVV--DQGEKFNLGYDIGDRVIKVGD--VEFN------- 2777
            |: :...|| .|.|.  .||..|....|.  || |...:.::...||.|:.|  ||:|       
 Worm  2302 HLEISSSGTQRNQKITRTFDAAGRVASVEQNDQ-EPVRIIWNSDARVEKINDRVVEWNRGGALKT 2365

  Fly  2778 ------NYDARGFVVKRGEQK-YRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQY 2835
                  ..|:.|:||||.... :.|:.:|:|: |....:.:...:||...|:|...::| :...:
 Worm  2366 FQDISYQVDSIGWVVKRDNTTVFGYDGKGRLV-SARSSQLRINIFYDREDRVVQIQNSK-DFIHF 2428

  Fly  2836 YYANPRTPHLVTHVHFPKISRTMKLFYDDRDMLIALEHED-QRYYVATDQNGSPLAFF-DQNGSI 2898
            ||....||.||:  ||.|..:...|||||..:..|::.:| .||.:.||:..:..|.. |.|  :
 Worm  2429 YYGYIDTPKLVS--HFSKNGKISTLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIGDSN--V 2489

  Fly  2899 VKEMKRTPFGRIIKDTKPEF-FVPIDFHGGL-IDPHTKLVYTEQRQYDPHVGQWMTPLWET---- 2957
            ::.:.|:.||.::..:.... |:||.:.||: |...:..:....|..|.:..::|:...|.    
 Worm  2490 LRIIDRSVFGALLPSSSSSHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRL 2554

  Fly  2958 -LATEMSHPTDVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLN-----------------N 3004
             |..:.|:..|:.......    .|.:.:|...|.::|..|.|...|                 .
 Worm  2555 ELNEKFSNSIDLMALEIDR----QPFRVENVPEDFETWFSLAGLSPNLLPSAHLGLPASSAIVHR 2615

  Fly  3005 MQSSRYTKLAQYTPQASIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLL 3069
            :.||...||...|...::....||.|..:.|.    ..:||....|..|            .|||
 Worm  2616 LLSSFPRKLRPLTHLTTVLPTRLASDISLTSP----TSETSWSIDDVGF------------SNLL 2664

  Fly  3070 PRVSYRRGVFGEGVLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVK 3134
                    :..|....    |..:|.::....|..::|:|.:|:....||            |..
 Worm  2665 --------ILNEDATT----GEVMVEMLSDLKSEEREVISKLFDGVKSLD------------FAT 2705

  Fly  3135 DNVLKLRD----DNEELRRLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHR 3195
            ..::..|.    .|.:|......|:..|..::      ...:.|....:.:::.:..:..:...:
 Worm  2706 WGLVPTRHLWRAPNSKLELSSTSFSHFTMAVN------KDSVELRNGKSKIVVHFSENKAEIVKK 2764

  Fly  3196 ILKHAHKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLA 3258
            |::....|.....|..|::...||.:....|::.|..||...|.|.|:: |::...|:...||
 Worm  2765 IVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVSGYD-IEMKPAHQSGLLA 2826

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 62/154 (40%)
CRD2 1106..1151 CDD:276900 24/46 (52%)
EGF_2 1139..1162 CDD:285248 10/24 (42%)
Keratin_B2 1162..1330 CDD:279797 72/229 (31%)
EGF_2 1167..1194 CDD:285248 14/27 (52%)
DUF3844 1171..>1235 CDD:289707 27/118 (23%)
EGF_2 <1272..1294 CDD:285248 10/23 (43%)
NHL 1750..2065 CDD:302697 107/331 (32%)
NHL repeat 1784..1830 CDD:271320 15/51 (29%)
NHL repeat 1854..1888 CDD:271320 14/34 (41%)
NHL repeat 1911..1950 CDD:271320 8/40 (20%)
NHL repeat 1972..2005 CDD:271320 13/34 (38%)
NHL repeat 2039..2065 CDD:271320 9/26 (35%)
RHS_repeat 2183..2218 CDD:283287 9/35 (26%)
RhsA 2347..3020 CDD:225750 171/780 (22%)
YD_repeat_2x 2795..2836 CDD:273728 9/41 (22%)
Rhs_assc_core 2905..2980 CDD:274730 15/82 (18%)
Tox-GHH 3193..3268 CDD:292269 17/67 (25%)
ten-1NP_001254940.1 EGF_2 594..620 CDD:285248 11/26 (42%)
EGF_2 662..686 CDD:285248 10/24 (42%)
EGF_2 691..718 CDD:285248 14/27 (52%)
VESA1_N 792..>896 CDD:289551 43/111 (39%)
NHL 1305..1663 CDD:302697 117/369 (32%)
NHL repeat 1335..1372 CDD:271320 16/37 (43%)
NHL repeat 1445..1476 CDD:271320 12/32 (38%)
NHL repeat 1492..1540 CDD:271320 10/48 (21%)
NHL repeat 1566..1600 CDD:271320 13/34 (38%)
NHL repeat 1637..1663 CDD:271320 9/26 (35%)
Tox-GHH 2763..2835 CDD:292269 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75005721
eggNOG 1 0.900 E1_KOG1225
Hieranoid 1 1.000
Homologene 1 1.000 H22672
Inparanoid 1 1.050 786 1.000 Inparanoid score I260
Isobase 1 0.950 0 Normalized mean entropy S5549
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000499
OrthoInspector 1 1.000 T374883
orthoMCL 1 0.900 OOG5_128674
Panther 1 1.100 LDO PTHR11219
Phylome 1 0.910 0.978 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3314
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.