DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ten-m and tnn

Sequence 1:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster
Sequence 2:XP_017949080.1 Gene:tnn XenbaseID:XB-GENE-998034 Length:1093 Species:Xenopus tropicalis

Alignment Length:890 Identity:215/891 (24%)
Similarity:326/891 (37%) Gaps:219/891 (25%)


  Fly  1068 TQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLRH 1132
            |::|||.|:|||:|:.|.|||.||:.|.||||.|||..|.::|...:|.|.|..|:.|..|  |.
 Frog   149 TKSCPNNCAGNGKCIDGVCQCAPGYSGPDCSEKVCPFDCGKYGTCEDGSCKCAEGYTGPAC--RK 211

  Fly  1133 DECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCICKKGWKGPDCATM 1197
            .:|.. ||...|.||.|.|||..||.|..|.:..|| .:|..||.|.||:|.|.:|:||.||.. 
 Frog   212 KKCPF-DCGEFGTCVDGTCQCSEGYTGPACRKKKCP-LDCGEHGKCIDGSCKCSEGYKGVDCKE- 273

  Fly  1198 DQDALQCLPD--------------------------CSGHGTFDLDTQTCTCEAKWSGDDCSKEL 1236
            .:.|:.|.|:                          |||||.:.:||..|.|:..|.|.|||:..
 Frog   274 KKCAVDCGPNGRCVDGQCVCNDGFMGSSCSIEIASLCSGHGKYLMDTGGCQCDDGWEGTDCSQRS 338

  Fly  1237 CDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPN 1301
            |..:|..:|.|....|.|...:.|..|:.|.|...|.|||.|.:|.|.|..|:.|..|..|.|..
 Frog   339 CPNNCDNNGVCVDGVCQCFSGYTGLDCSERECPFDCGEHGSCVDGACKCSVGYTGLTCREEDCLV 403

  Fly  1302 SCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELN-------CGDSKDNDKDGLVDCEDPECCA 1359
            :|..:|:|    :| .:|.|.||:.|.||...:.:.       ..||.....|.|::        
 Frog   404 NCGENGRC----DG-GQCFCEEGFIGEDCSEVITVQNLHLISATEDSLSIAWDMLLE-------- 455

  Fly  1360 SHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYA-KLETFNESIFWNYFN 1423
                            :|..|....|.......:.::..:|:.:.|... ...|..:.:.:|..|
 Frog   456 ----------------VDYYLLVYYPLDNEGLKKEIQVSVDKDTYQIMGLNPGTKYKVLMYNAKN 504

  Fly  1424 --ASRSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRP 1486
              .|:.|.:..: ..|:.:|.:.|...|...||                                
 Frog   505 GVTSQPAELLAK-TDSISLGTLWVAEETEDSLE-------------------------------- 536

  Fly  1487 QSRIVQVPW-NEVVIID---------------LVVMSMSEEKGLAVTTTHTCFAHDYDLMKPVVL 1535
                  |.| |.:|.:|               .|::|.|::.....|.|....:..|.:....|.
 Frog   537 ------VEWENPIVNVDHYKLKYAQQLNGAEREVIVSQSQDPKSRYTITGLQPSTSYQISVQTVR 595

  Fly  1536 A------SWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI-KLQLTPD 1593
            :      |...|..|....::.:..|......||...|:..::..:..|.:.:.... ::.|..:
 Frog   596 SGLEGKPSTAVGVTGIDGPKNLVTTEVGEDTASLSWKGSQADIDKYMLRYSAHDGIAEEISLGKE 660

  Fly  1594 VIPTSLHLIHLRITIEGILFERIFEADPGIKFTY-AWNRLNIYRQRVYGVTTAVVKV----GYQY 1653
            .|.|||.                 ...||.::.: .|......:.:...| |||.::    ..||
 Frog   661 KISTSLS-----------------NLTPGTEYMFHLWAEKGTQQSKRTSV-TAVTEIDPPKNLQY 707

  Fly  1654 TDC---TDIVWDIQTTKLSGHDMSISEVGGWNLDIH---HRYNFHEGILQKGDGSNIYLRNKPRI 1712
            :..   ..:.|:....::.|:.:.:.:..|...:|.   ...||....|.||....:||      
 Frog   708 SKSQPQASLTWNQPIAQIDGYVLVLEDSDGGQQEIQLDSTVNNFELQDLNKGLKYTVYL------ 766

  Fly  1713 ILTTMGDGHQRPLEC---PDCDGQATKQRL---LAPVALAAAPDGSLFVGDFNYIRRIM-TDGSI 1770
             |...||...|.:..   .|.|.....|..   ....:|...|..:...|   ||.... .|||.
 Frog   767 -LAYRGDRRSRQVTTSFYTDIDPPTNLQSFDVTQTEASLTWTPPRAKIDG---YILTYTDADGST 827

  Fly  1771 RTVVKLNATRVSYRYHMALSPLDGTLYVS----DPESHQIIRVRDT--------NDYSQPELNWE 1823
            .. ::|:::..|:........|..|:|::    |..|.|...:..|        :|..|.:|   
 Frog   828 EE-IQLDSSSKSFAMKNLKKGLKYTVYLTAFKGDSRSSQASTIFSTVAFIITHPSDCIQIQL--- 888

  Fly  1824 AVVGSGER------CLPGDEAHCGDGALAKDAKLAYPKGIAISSD 1862
                ||.|      ..||     ||.|          ||:.:..|
 Frog   889 ----SGNRQSGVYTIYPG-----GDTA----------KGVRVYCD 914

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 60/129 (47%)
CRD2 1106..1151 CDD:276900 16/45 (36%)
EGF_2 1139..1162 CDD:285248 12/23 (52%)
Keratin_B2 1162..1330 CDD:279797 66/194 (34%)
EGF_2 1167..1194 CDD:285248 14/27 (52%)
DUF3844 1171..>1235 CDD:289707 30/90 (33%)
EGF_2 <1272..1294 CDD:285248 10/22 (45%)
NHL 1750..2065 CDD:302697 29/133 (22%)
NHL repeat 1784..1830 CDD:271320 12/58 (21%)
NHL repeat 1854..1888 CDD:271320 3/10 (30%)
NHL repeat 1911..1950 CDD:271320
NHL repeat 1972..2005 CDD:271320
NHL repeat 2039..2065 CDD:271320
RHS_repeat 2183..2218 CDD:283287
RhsA 2347..3020 CDD:225750
YD_repeat_2x 2795..2836 CDD:273728
Rhs_assc_core 2905..2980 CDD:274730
Tox-GHH 3193..3268 CDD:292269
tnnXP_017949080.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.