DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and SKY1

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_013943.1 Gene:SKY1 SGDID:S000004829 Length:742 Species:Saccharomyces cerevisiae

Alignment Length:836 Identity:261/837 (31%)
Similarity:379/837 (45%) Gaps:208/837 (25%)


  Fly   226 TSSQSTTKLSYRDDF----------LQQIGY-LPTTRIYSTPTSIVDEDKAQ--QDFLSLSLSPP 277
            ||||...|..::.|:          ..::.. |.|::..|:....|.||.:.  :||.:.|    
Yeast    32 TSSQEAKKNFFQRDYNMMKKAPAPTKSKLSLALQTSKSSSSANGTVQEDTSSKTEDFSTKS---- 92

  Fly   278 LNRRRDMPALRGPFVSLSEPRGTLSTTDEIYPDSSDSSLYVSDEEQEDA-SQYCRGGYHPVVIGD 341
            :.::.|...  ...||:....|..|.:|.    .||||:...||..|:: ..|..|||||...|:
Yeast    93 IKKKPDSGV--ESHVSIQSDSGPQSDSDL----DSDSSISSCDERNEESLKDYRPGGYHPAFKGE 151

  Fly   342 IF-DNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMD 405
            .: |.|:.:||||||||||||||.:|:.:..:||:|:|:....|.|.|.|||:||:.:.|||  :
Yeast   152 PYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEIKLLQRVNDAD--N 214

  Fly   406 VKRE-----RIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLE 465
            .|.:     .|::|::||..:|.||:|..:|||.||.:|..||.|..::|:.:..|:.|.:|:|.
Yeast   215 TKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISKQLLL 279

  Fly   466 GLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDD-EINSLRVKGVDFPDSYISSIEKQTKSR 529
            ||||:|.:|.||||||||||:|:.|.:...:.|.::. :......|.:....|..|.|.....|.
Yeast   280 GLDYMHRRCGIIHTDIKPENVLMEIGDVEGIVQMVEALDKQKREAKRLQRHVSRSSDITANDSSD 344

  Fly   530 AKWPLIEPNGSTNTNTNTSNSTA---------------TNSNSSTPLAAVIMSTLDKEDTTTTTS 579
            .||...:.:....:::|:.:.:.               |....|.||.:.|.|:...|.......
Yeast   345 EKWAECQTSMPCGSSSNSKSRSIEKDLSKRCFRRPRRHTIITGSQPLPSPISSSNFFEMRAHFCG 409

  Fly   580 STLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLGEQS 644
            |:.||.::.|......|.:.::..|.|: |..|.||.:                           
Yeast   410 SSHNSFSSVSGNRNIPSSINNNSINNGI-GIKNSNNSF--------------------------- 446

  Fly   645 TLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNILS 709
                             |:|.|::|....   |.|....|:.|.:         :|:|.|:|   
Yeast   447 -----------------LNSVPHSVTRMF---INEDSNDNNNNDN---------SKNKNNNN--- 479

  Fly   710 TCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATST 774
                 .::|    .|.|....:||                                         
Yeast   480 -----NNSN----NNNNEDIMNTP----------------------------------------- 494

  Fly   775 TCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTY 839
                    ...:....|.||...||.                              ||||..|..
Yeast   495 --------LHEEQLADSLSTFDISNI------------------------------SQSSDTNGP 521

  Fly   840 TIQSLID-NSNV-----------RVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTAD 892
            .|.:.:| ||||           ::|||||||||:...|:|..||||:|||.|||||||:...||
Yeast   522 YISNTMDSNSNVSTDINSPENLIQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGAD 586

  Fly   893 IWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLR 957
            |||||||.|||.|||:||:|..|.||::|:||:|.|:||||.:|..::..||:...:|.|.|.||
Yeast   587 IWSTACLIFELITGDFLFEPDEGHSYTKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSRGLLR 651

  Fly   958 NITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWLE 1013
            ||:|||.|.|.:||.|||.:...|||:.||||.|||:.:|..||.|...:.||||:
Yeast   652 NISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWLK 707

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 76/175 (43%)
S_TKc 347..>492 CDD:214567 71/150 (47%)
STKc_SRPK <844..1012 CDD:271038 97/180 (54%)
SKY1NP_013943.1 PKc_like 155..706 CDD:304357 225/701 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 376 1.000 Inparanoid score I340
Isobase 1 0.950 0 Normalized mean entropy S2039
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 1 1.000 T634414
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.