DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and AT5G22840

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_197675.1 Gene:AT5G22840 AraportID:AT5G22840 Length:538 Species:Arabidopsis thaliana

Alignment Length:707 Identity:213/708 (30%)
Similarity:296/708 (42%) Gaps:253/708 (36%)


  Fly   312 SDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVR-KLGWGHFSTVWLCRDLKDEKYVAL 375
            ||:|.|.|  |.|....|.|||||.|.:||.|.|...|:: ||||||||||||..|..:.:||||
plant    11 SDASDYSS--EDEGTEDYRRGGYHTVRVGDTFKNGSYVIQSKLGWGHFSTVWLAWDTLNSRYVAL 73

  Fly   376 KVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLY 440
            |:.|||.||.|.|.|||::|:.|.:.|..|  ::.:|:|::||...|.||.|.|:|||.||.:|.
plant    74 KIQKSAQHYTEAAMDEIKILKQIAEGDAED--KKCVVKLLDHFKHAGPNGQHVCMVFEYLGDNLL 136

  Fly   441 KLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEIN 505
            .:|..::|:|:.:..|:.|...:|.||||||.:.||||||||||||||.        ..||.|.:
plant   137 SVIKYSDYRGVPLHMVKEICFHILVGLDYLHRELSIIHTDIKPENILLC--------STIDPEAD 193

  Fly   506 SLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLD 570
            : |..|:                    ||:.|               |..:.:.|...|     :
plant   194 A-RKSGI--------------------PLVLP---------------TVKDKAVPERPV-----E 217

  Fly   571 KEDTTT-TTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDED 634
            ||...: |.|:.|..|....:..|...:.|..|           |.|                  
plant   218 KEKPKSYTYSADLTKNQKKKIRKKAKKVEGSEE-----------NER------------------ 253

  Fly   635 AESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIA 699
                                                             :|:||....:..||:.
plant   254 -------------------------------------------------DSSNSEARPNGNATVE 269

  Fly   700 KSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIA 764
            :.:                                                              
plant   270 RLE-------------------------------------------------------------- 272

  Fly   765 PSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQN 829
                                           .:|..:..|                       :|
plant   273 -------------------------------ESSERVKDA-----------------------EN 283

  Fly   830 QSQSSQNN----TYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYT 890
            .||.|:.|    ..|.|.|:.:.:.:.|:.|.||||:.|..||.||||||||..||:||:.|:.:
plant   284 VSQKSRGNRRGSQSTRQKLLADVDRKCKLVDFGNACWTYKQFTSDIQTRQYRCPEVVLGSKYSTS 348

  Fly   891 ADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGS 955
            ||:||.||:.|||||||.|||||:||::.|||||||.::||||.:|:.:...|:|...:|...|.
plant   349 ADMWSFACICFELATGDVLFDPHSGENFERDEDHLALMMELLGMMPRKIALGGRHSRDFFNRQGE 413

  Fly   956 LRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            ||:|.:|:.|.|..||.:|||:...:|....||:.|:|::.|..|.:||:||.||||
plant   414 LRHIRRLRFWPLSKVLTDKYDFSEEDAIAMQDFITPILQFVPEKRPTAAQCLTHPWL 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 82/169 (49%)
S_TKc 347..>492 CDD:214567 74/146 (51%)
STKc_SRPK <844..1012 CDD:271038 84/168 (50%)
AT5G22840NP_197675.1 STKc_SRPK 34..470 CDD:271038 199/681 (29%)
S_TKc 45..470 CDD:214567 194/670 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 389 1.000 Inparanoid score I489
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoInspector 1 1.000 T32124
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.857 Consistency score
87.980

Return to query results.
Submit another query.