DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and AT4G35500

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_974689.1 Gene:AT4G35500 AraportID:AT4G35500 Length:439 Species:Arabidopsis thaliana

Alignment Length:706 Identity:188/707 (27%)
Similarity:260/707 (37%) Gaps:295/707 (42%)


  Fly   312 SDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFD-NRFRVVRKLGWGHFSTVWLCRD-LKDEKYVA 374
            |.||...|:.|:|....|.:||||.|.|||.|. .|:...||||||.||||||..| |.....:.
plant     2 SCSSSSGSEGEEEGFDAYRKGGYHAVRIGDPFSGGRYIAQRKLGWGQFSTVWLAYDTLTSNVLLC 66

  Fly   375 LKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSL 439
            :.:...|..:.:.|..||..|.|..|.| :| |.:.:|||::||...|.||.|.|:|.|.||.||
plant    67 MFLCLFAQQFAQAALHEIEFLSAAADGD-LD-KTKCVVRLIDHFKHSGPNGQHLCMVLEFLGDSL 129

  Fly   440 YKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILL--VIDNAAAMNQQIDD 502
            .:||..|.|:||.:.:||.|.|.:|.||||||.:..:||:|:|||||||  .||.|       .|
plant   130 LRLIRYNQYKGLKLNKVREICRCILTGLDYLHRELGMIHSDLKPENILLCSTIDPA-------KD 187

  Fly   503 EINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIE-PNGSTNTNTNTSNSTATNSNSSTPLAAVIM 566
            .:.|    |:.                   ||:| |.|:.|                        
plant   188 PVRS----GLT-------------------PLLEKPEGNAN------------------------ 205

  Fly   567 STLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDC 631
                                                     ||::.:|   ..|||:..:     
plant   206 -----------------------------------------GGASTMN---LIEKKLKRR----- 221

  Fly   632 DEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTA 696
                                                                            |
plant   222 ----------------------------------------------------------------A 222

  Fly   697 TIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFT 761
            ..|.:||:...:|..|                                                 
plant   223 KRAVAKISERRVSMVT------------------------------------------------- 238

  Fly   762 QIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIP 826
                                   |:..::.|                                  
plant   239 -----------------------GEEASSKT---------------------------------- 246

  Fly   827 SQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTA 891
                           :..:|..::|.|:.|.||||:....|.|:|||||||:.||:|.:.|:::.
plant   247 ---------------EKSLDGIDMRCKVVDFGNACWADKQFAEEIQTRQYRAPEVILKSGYSFSV 296

  Fly   892 DIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSL 956
            |:||..|.||||.|||.||.|..|..|..||||||.::||||.:|:.:...|.....||..:|.|
plant   297 DMWSFGCTAFELVTGDMLFAPKDGNGYGEDEDHLALMMELLGKMPRKIAIGGAKSKDYFDRHGDL 361

  Fly   957 RNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            :.|.:||.|.|..:|::||.....|||:|::||.|:||:.|..|.:|.:||.|||:
plant   362 KRIRRLKYWPLDRLLIDKYKLPEAEAKEFAEFLTPILEFAPEKRPTAQQCLDHPWM 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 77/172 (45%)
S_TKc 347..>492 CDD:214567 69/148 (47%)
STKc_SRPK <844..1012 CDD:271038 78/168 (46%)
AT4G35500NP_974689.1 STKc_SRPK 27..417 CDD:271038 177/680 (26%)
S_TKc 38..417 CDD:214567 171/669 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 389 1.000 Inparanoid score I489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoInspector 1 1.000 T32124
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.857 Consistency score
76.970

Return to query results.
Submit another query.