DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and SRPK4

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_566977.1 Gene:SRPK4 AraportID:AT3G53030 Length:529 Species:Arabidopsis thaliana

Alignment Length:703 Identity:216/704 (31%)
Similarity:297/704 (42%) Gaps:244/704 (35%)


  Fly   311 SSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIF-DNRFRVVRKLGWGHFSTVWLCRDLKDEKYVA 374
            :||...|.|  |.|....|.|||||.|.|||.| ..|:.|..||||||||||||..|.:..:|||
plant     7 NSDGGEYTS--EDEGTEDYRRGGYHAVRIGDSFKTGRYVVQSKLGWGHFSTVWLSWDTQSSRYVA 69

  Fly   375 LKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSL 439
            |||.|||.||.|.|.|||.:|:.|.:.|..|.|  .:|:|::||...|.||.|.|:|||.||.:|
plant    70 LKVQKSAQHYTEAAMDEITILQQIAEGDTDDTK--CVVKLLDHFKHSGPNGQHVCMVFEYLGDNL 132

  Fly   440 YKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEI 504
            ..||..::|:||.|..|:.|...:|.||||||.:.||||||:||||:||                
plant   133 LTLIKYSDYRGLPIPMVKEICYHMLVGLDYLHKQLSIIHTDLKPENVLL---------------- 181

  Fly   505 NSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTL 569
                       .|.|...:...||.|  ||:.|.                               
plant   182 -----------PSTIDPSKDPRKSGA--PLVLPT------------------------------- 202

  Fly   570 DKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDED 634
            ||::|      .::||             ||...|...|.        ..:.|::|:...:...:
plant   203 DKDNT------VVDSN-------------GDFVKNQKTGS--------HRKAKLSAQGHAENKGN 240

  Fly   635 AESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIA 699
            .|||                          |...|..|..|                        
plant   241 TESD--------------------------KVRGVGSPVNG------------------------ 255

  Fly   700 KSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIA 764
                     ..|.:..|..|.|                   ||::.|:.                
plant   256 ---------KQCAAEKSVEEDC-------------------PSTSDAIE---------------- 276

  Fly   765 PSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQN 829
                              .||..|...                                  ..:.
plant   277 ------------------LDGSEKGKQ----------------------------------GGKK 289

  Fly   830 QSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIW 894
            .|:||:.:      |:.:::::.|:.|.||||:.|..||.||||||||..||:||:.|:.:||:|
plant   290 GSRSSRRH------LVASADLKCKLVDFGNACWTYKQFTSDIQTRQYRCPEVILGSKYSTSADLW 348

  Fly   895 STACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNI 959
            |.||:.|||.|||.|||||:|::|.|||||||.::||||.:|:.:...|::...:|..:|.||:|
plant   349 SFACICFELVTGDVLFDPHSGDNYDRDEDHLALMMELLGMMPRKIALGGRYSRDFFNRHGDLRHI 413

  Fly   960 TKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            .:|:.|.:..||.|||::...:|...||||:.:|::.|..|.:||:||.|||:
plant   414 RRLRFWPMNKVLTEKYEFSEQDANDLSDFLVSILDFVPEKRPTAAQCLLHPWI 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 83/169 (49%)
S_TKc 347..>492 CDD:214567 77/145 (53%)
STKc_SRPK <844..1012 CDD:271038 82/168 (49%)
SRPK4NP_566977.1 STKc_SRPK 31..466 CDD:271038 204/676 (30%)
S_TKc 42..466 CDD:214567 198/665 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 389 1.000 Inparanoid score I489
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoInspector 1 1.000 T32124
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.