DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and AT3G44850

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_190071.1 Gene:AT3G44850 AraportID:AT3G44850 Length:534 Species:Arabidopsis thaliana

Alignment Length:701 Identity:214/702 (30%)
Similarity:300/702 (43%) Gaps:232/702 (33%)


  Fly   312 SDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVR-KLGWGHFSTVWLCRDLKDEKYVAL 375
            :|.|.|.|  |.|....|.:||||.|.:||.|.|...|:: ||||||||||||..|.::.:||||
plant    11 NDESEYSS--EDEGTEDYKKGGYHTVRVGDTFKNGAYVIQSKLGWGHFSTVWLAWDTQESRYVAL 73

  Fly   376 KVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLY 440
            ||.|||.||.|.|.|||::|:.|.:.|..|  ::.:|:|::||...|.||.|.|:|||.||.:|.
plant    74 KVQKSAQHYTEAAMDEIKILKQIAEGDSGD--KKCVVKLLDHFKHTGPNGKHVCMVFEYLGDNLL 136

  Fly   441 KLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEIN 505
            .:|..::|:|:.:..|:.:...:|.||||||.:.||||||:||||:||:         ...|...
plant   137 SVIKYSDYRGVPLHMVKELCFHILVGLDYLHRELSIIHTDLKPENVLLL---------STIDPSR 192

  Fly   506 SLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLD 570
            .:|..||                    ||:.|                    .|....|..|.:.
plant   193 DVRRSGV--------------------PLVLP--------------------ITKDKIVSESAVK 217

  Fly   571 KEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDA 635
            .|..:.|.:..|..|....:..|                          .||:.|:..|      
plant   218 PETKSYTYNGDLTKNQKKKIRKK--------------------------AKKVVAQDFG------ 250

  Fly   636 ESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAK 700
                 ||::...|..||    :.|..::.  |:..|.|||                         
plant   251 -----GEEALEESERDS----NSEARING--NSTVERSEG------------------------- 279

  Fly   701 SKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAP 765
                                                                             
plant   280 ----------------------------------------------------------------- 279

  Fly   766 SATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQ 830
                        :|....:|:.                          |..|.|       .:|.
plant   280 ------------SSTRLMEGEE--------------------------AREKAN-------KKNG 299

  Fly   831 SQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWS 895
            ..|.:.:..|.|.|:.:...:.|:.|.||||:.|..||.||||||||..||:||:.|:.:||:||
plant   300 RGSRRGSRSTRQKLLSDIECKCKLVDFGNACWTYKQFTSDIQTRQYRCPEVVLGSKYSTSADMWS 364

  Fly   896 TACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNIT 960
            .||:.|||||||.|||||:||:|.|||||||.::||||.:|:.:...|::...:|...|.||:|.
plant   365 FACICFELATGDVLFDPHSGENYDRDEDHLALMMELLGMMPRKIALGGRYSRDFFNRQGELRHIR 429

  Fly   961 KLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPW 1011
            :|:.|.:..||.||||:...:||..||||:.:||:.|..|.:||:||:|||
plant   430 RLRFWPISKVLKEKYDFSEQDAKDMSDFLVTILEFVPEKRPTAAQCLKHPW 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 78/169 (46%)
S_TKc 347..>492 CDD:214567 72/146 (49%)
STKc_SRPK <844..1012 CDD:271038 87/169 (51%)
AT3G44850NP_190071.1 STKc_SRPK 34..481 CDD:271038 203/677 (30%)
S_TKc 45..481 CDD:214567 198/666 (30%)
PKc_like <156..>223 CDD:304357 30/116 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 389 1.000 Inparanoid score I489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoInspector 1 1.000 T32124
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.857 Consistency score
76.970

Return to query results.
Submit another query.