DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and AT2G17530

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001189542.1 Gene:AT2G17530 AraportID:AT2G17530 Length:440 Species:Arabidopsis thaliana

Alignment Length:705 Identity:195/706 (28%)
Similarity:266/706 (38%) Gaps:295/706 (42%)


  Fly   312 SDSSLYVSDEEQEDASQYCRGGYHPVVIGDIF-DNRFRVVRKLGWGHFSTVWLCRDLKDEKYVAL 375
            |.||...|:|:.|....|.:||||.|.|||.| ..|:...||||||.||||||..|.:...||||
plant     2 SCSSSSGSEEDDEGFDAYRKGGYHAVRIGDQFAGGRYIAQRKLGWGQFSTVWLAYDTRTSNYVAL 66

  Fly   376 KVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLY 440
            |:.|||..:.:.|..||.||:|..|.||.:.|  .::||::.|...|.||.|.|:|.|.||.||.
plant    67 KIQKSALQFAQAALHEIELLQAAADGDPENTK--CVIRLIDDFKHAGPNGQHLCMVLEFLGDSLL 129

  Fly   441 KLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILL--VIDNAAAMNQQIDDE 503
            :||..|.|:|:.:::||.|.:.:|.||||||.:..:||:|:|||||||  .||.|       .|.
plant   130 RLIKYNRYKGMELSKVREICKCILTGLDYLHRELGMIHSDLKPENILLCSTIDPA-------KDP 187

  Fly   504 INSLRVKGVDFPDSYISSIEKQTKSRAKWPLIE-PNGSTNTNTNTSNSTATNSNSSTPLAAVIMS 567
            |.|    |:.                   |::| |.|:       .|.|:|            |:
plant   188 IRS----GLT-------------------PILEKPEGN-------QNGTST------------MN 210

  Fly   568 TLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCD 632
            .::|:                                           ..|..||..||.||   
plant   211 LIEKK-------------------------------------------LKRRAKKAAAKISG--- 229

  Fly   633 EDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTAT 697
              .....:|                                   :.|.|..|..|          
plant   230 --RRVSIVG-----------------------------------LSETPKKNKRN---------- 247

  Fly   698 IAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQ 762
                                                                             
plant   248 ----------------------------------------------------------------- 247

  Fly   763 IAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPS 827
                                                                             
plant   248 ----------------------------------------------------------------- 247

  Fly   828 QNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTAD 892
                             :|..::|.|:.|.||.|:..:.|.|:|||||||:.||:|.:.|:|:.|
plant   248 -----------------LDGIDMRCKVVDFGNGCWADNKFAEEIQTRQYRAPEVILQSGYSYSVD 295

  Fly   893 IWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLR 957
            :||.||.||||||||.||.|..|..|..||||||.::||||.:|:.:...|.....||..:|.|:
plant   296 MWSFACTAFELATGDMLFAPKEGNGYGEDEDHLALMMELLGKMPRKIAIGGARSKDYFDRHGDLK 360

  Fly   958 NITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            .|.:||.|.|..:|::||.....||::|:|||.|::::.|..|.:|.:|||||||
plant   361 RIRRLKYWPLDRLLIDKYKLPEAEAREFADFLCPIMDFAPEKRPTAQQCLQHPWL 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 80/171 (47%)
S_TKc 347..>492 CDD:214567 72/147 (49%)
STKc_SRPK <844..1012 CDD:271038 79/168 (47%)
AT2G17530NP_001189542.1 STKc_SRPK 27..415 CDD:271038 183/679 (27%)
S_TKc 38..415 CDD:214567 177/668 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 389 1.000 Inparanoid score I489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoInspector 1 1.000 T32124
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.857 Consistency score
76.970

Return to query results.
Submit another query.