DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and si:ch211-220i18.4

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_021325577.1 Gene:si:ch211-220i18.4 ZFINID:ZDB-GENE-090312-151 Length:448 Species:Danio rerio

Alignment Length:762 Identity:217/763 (28%)
Similarity:280/763 (37%) Gaps:349/763 (46%)


  Fly   276 PPLNRRRDMPALRG-PFVSLSEPRGTLSTTDEIYPDSSDSSLYVSD------------------- 320
            |...|||:....|. |.:   :|.|..:...|..|::..:.|..|.                   
Zfish    11 PSTLRRREGGGCRADPII---KPGGASTAELERNPENQHNLLLKSHVVMDSKLKSIRHYEHLEPD 72

  Fly   321 --EEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPH 383
              ||.||...||.||||||.:||||:.|::|:.|||||:|||||||.||:..::||:||:||...
Zfish    73 LAEEFEDPRDYCYGGYHPVQVGDIFNKRYKVLSKLGWGYFSTVWLCVDLRSGRHVAVKVLKSGAG 137

  Fly   384 YIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSL--YKLIVKN 446
            :.:...||:.||.........:..:.|||:|::.|.:.||||:|.|||.|.||..|  :::...|
Zfish   138 FTQAGQDELTLLRCASGPTARNPLKGRIVQLLDEFKLAGVNGIHICLVLELLGPDLRCWQMCFGN 202

  Fly   447 NYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKG 511
              .||:::.|:::|.||||||:||||.|.|||||||||||||..                     
Zfish   203 --PGLSLSCVKHVITQVLEGLEYLHSHCKIIHTDIKPENILLCF--------------------- 244

  Fly   512 VDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLDKEDTTT 576
                                                                             
Zfish   245 ----------------------------------------------------------------- 244

  Fly   577 TTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLG 641
                                                                             
Zfish   245 ----------------------------------------------------------------- 244

  Fly   642 EQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSN 706
                                       .|.|..|.|               |   |.:.|.|.:.
Zfish   245 ---------------------------TPHPPGGDI---------------H---TYSSSAIRNT 264

  Fly   707 ILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPA 771
            :|.                                                           ||.
Zfish   265 VLK-----------------------------------------------------------APG 270

  Fly   772 TSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQN 836
            .|                                          .||....|.            
Zfish   271 ES------------------------------------------GKLGTWGNL------------ 281

  Fly   837 NTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAF 901
                       .::.|||||||::|:.|.||.::||||||||:|||||:.|...|||||.|||||
Zfish   282 -----------EDITVKIADLGSSCWVYKHFCQEIQTRQYRSLEVLLGSEYGPAADIWSVACLAF 335

  Fly   902 ELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWS 966
            ||||||.||:|.||.::|.:|||||||:||||.||.||...||:..:||...|.||.|..|:||.
Zfish   336 ELATGDSLFEPKAGPNFSLEEDHLAHIIELLGKIPVSVAQCGKYYYEYFNRKGDLRRIAVLRPWG 400

  Fly   967 LMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWLE 1013
            |..||||||.:...||..||||||.||.|.|..||:||:||:||||:
Zfish   401 LYEVLVEKYHFLLREASLFSDFLLQMLNYLPERRATAAQCLKHPWLK 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 78/170 (46%)
S_TKc 347..>492 CDD:214567 71/147 (48%)
STKc_SRPK <844..1012 CDD:271038 101/168 (60%)
si:ch211-220i18.4XP_021325577.1 STKc_SRPK 90..446 CDD:271038 194/678 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.654 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.