DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and srpk1b

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_005155715.1 Gene:srpk1b ZFINID:ZDB-GENE-070112-2292 Length:643 Species:Danio rerio

Alignment Length:770 Identity:282/771 (37%)
Similarity:387/771 (50%) Gaps:158/771 (20%)


  Fly   270 LSLSLSPPLNRRRDMPALRGPFVSLS------------EPRGTLSTTDEIYPDSSDSSLYVSDEE 322
            |||:..|.|           |.::||            .|||.....|.: .:..:..|...|||
Zfish     3 LSLACQPLL-----------PSLALSLMGIRASCRPDPHPRGAAQQPDAL-QEQDEEILGSDDEE 55

  Fly   323 QEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIET 387
            |||.:.||:||||.|.|||:|:.|:.|:|||||||||||||..|.:.:::||:||||||.||.||
Zfish    56 QEDPNDYCKGGYHHVKIGDLFNGRYHVIRKLGWGHFSTVWLAWDTQGKRFVAMKVVKSAEHYTET 120

  Fly   388 AADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLA 452
            |.|||:||:|:|:.|..|..||::|:|::.|.:.||||.|.|:|||.||..|.|.|:|:|||||.
Zfish   121 ALDEIKLLKAVRNTDQNDPSREKVVQLLDDFKISGVNGTHVCMVFEVLGHHLLKWIIKSNYQGLP 185

  Fly   453 IAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPDS 517
            :..|::||||||:||||||:||.||||||||||||:                        |..::
Zfish   186 LPCVKSIIRQVLQGLDYLHTKCKIIHTDIKPENILM------------------------DVNEA 226

  Fly   518 YISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLDKEDTTTTTSSTL 582
            |:..:..:.....|.....|:||            ..|.:..|..|..||.              
Zfish   227 YVKRLAAEATEWQKSGAPPPSGS------------AVSTAPAPKQATKMSK-------------- 265

  Fly   583 NSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLGEQSTLA 647
                                           |.:.:.:||          :..:::.|.::....
Zfish   266 -------------------------------NKKKKMKKK----------QKRQAELLEKRILEI 289

  Fly   648 STMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNILSTCT 712
            ..::...|...|.:.|               |..||:||.|...||....|          ||.|
Zfish   290 EGLEKGLDGGEEEDED---------------ETETPDSTPSVPSSHTLQDI----------STET 329

  Fly   713 SLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTT-- 775
            :|..|:|.....|.:.....||.....:......:...||.:..........|:...||.:.|  
Zfish   330 TLDGTSEAWSQVTGSVNGHIPSPEDEQSLDVQQQMKDETPVNPYDSGNETSEPTNPYPACNGTEE 394

  Fly   776 ------CTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVH--ANAIPSQNQS- 831
                  |.::|   ||:....|....:....:....:.||......|::...  ..|:|.:.:| 
Zfish   395 TEPSPACLSAA---DGNGALISGMVESQGCRVQDGESLTAELKDPRAEMEAEPGTQAVPEEEESL 456

  Fly   832 ----QSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTAD 892
                .::.|........::...::||||||||||:.:.|||:|||||||||:|||:|..|...||
Zfish   457 KDAKTAAGNLLVNPLEPLNAEKIQVKIADLGNACWVHKHFTDDIQTRQYRSLEVLIGTGYGTPAD 521

  Fly   893 IWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLR 957
            ||||||:|||||||||||:||:||.|||||||:|.|:||||.||:.::..||:..::||..|.||
Zfish   522 IWSTACMAFELATGDYLFEPHSGEDYSRDEDHIALIIELLGKIPRKLVMNGKYSKEFFTKKGDLR 586

  Fly   958 NITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            :|||||||.|.:||||||:|...||:.|||||||||:..|..||:|||||:|.|:
Zfish   587 HITKLKPWGLQDVLVEKYEWHREEAQNFSDFLLPMLDLIPEKRATAAECLRHSWI 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 95/168 (57%)
S_TKc 347..>492 CDD:214567 89/145 (61%)
STKc_SRPK <844..1012 CDD:271038 108/168 (64%)
srpk1bXP_005155715.1 PKc_like 70..>256 CDD:304357 102/222 (46%)
S_TKc 80..>224 CDD:214567 90/168 (54%)
PKc_like <465..641 CDD:304357 109/176 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.615 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.